aarete
aarete5mo ago

Business Systems Analyst- Payment Intelligence

IndiaIndia·Punemid
Business Systems AnalystBusiness Analysis & Process
4 views0 saves0 applied

Quick Summary

Overview

Business Systems Analyst AArete is one-of-a-kind when it comes to consulting firm culture. We’re a global, innovative management and technology consulting firm with offices in the U.S., India, and Europe.

Key Responsibilities

We are hiring a Business Systems Analyst to join our team within the Data Architecture & Engineering practice. You will serve as the bridge between business stakeholders and the engineering team - translating healthcare payer business requirements…

Requirements Summary

4+ years of experience as a Business Analyst, Business Systems Analyst, or similar role in a data-intensive environment Strong SQL skills with the ability to write queries for data exploration, validation, and analysis in Snowflake or similar cloud…

Technical Tools
confluencejirapower-bipythonsnowflakesqlagiledata-analysisdatabase-designetl

A black and orange circle with black textDescription automatically generated

 

Business Systems Analyst

 

 

AArete is one-of-a-kind when it comes to consulting firm culture.

  

We’re a global, innovative management and technology consulting firm with offices in the U.S. and India. Our name comes from the Greek word for excellence: “Areté.”  And excellence is exactly what we strive for.  

 

We’re celebrating our fourth year as one of Forbes’ World’s Best Management Consulting Firms – and our success starts with our people. From robust career development planning to competitive life and wellness benefits, AArete’s “Culture of Care” takes a holistic approach to the employee experience.  

  

AAretians (our team members) are leaders at every level. You are encouraged to unlock your full potential by directly contributing to our mission and prioritizing personal development and fulfillment. 

 

 

The Role

 

We are hiring a Business Systems Analyst to join our team within the Data Architecture & Engineering practice. You will serve as the bridge between business stakeholders and the engineering team - translating healthcare payer business requirements into clear, actionable technical specifications that data engineers can build against.

This role is deeply embedded in the delivery process. You will work across edits development, contract configuration, fee schedule ingestion, and reporting workstreams to define requirements, document acceptance criteria, validate output, and ensure that what gets built matches what the business needs. You are not writing code, but you need to understand how data pipelines, Snowflake, and healthcare claims data work well enough to have credible technical conversations with engineers.

 

 

Work You’ll Do

  • Gather, analyze, and document business requirements from US-based consulting teams, project managers, and client delivery leads for workstreams including edits development, contract configuration, and fee schedule automation
  • Translate business requirements into detailed technical specifications, user stories, and acceptance criteria that data engineers can execute against
  • Partner with data engineers to clarify requirements during development, review output against specifications, and validate that deliverables meet business intent
  • Develop and maintain data dictionaries, business rules documentation, and process flow diagrams for data pipelines and analytics
  • Support the edits acceptance process by defining test scenarios, validating edits logic output against expected results, and triaging defects with the engineering team
  • Analyze healthcare claims data in Snowflake to support requirements definition, data quality investigation, and business rule validation
  • Create and maintain Power BI reports and dashboards that support delivery tracking, edit performance monitoring, and client reporting
  • Document and maintain process workflows, standard operating procedures, and runbooks in Confluence
  • Participate in sprint planning, backlog grooming, and sprint reviews as the voice of business requirements within the engineering team
  • Identify gaps, inconsistencies, and risks in requirements and proactively raise them with stakeholders before they become engineering problems
  • Other duties as assigned

Requirements

 

  • 4+ years of experience as a Business Analyst, Business Systems Analyst, or similar role in a data-intensive environment
  • Strong SQL skills with the ability to write queries for data exploration, validation, and analysis in Snowflake or similar cloud data warehouses
  • Experience writing detailed technical requirements, user stories, and acceptance criteria for data engineering or software development teams
  • Proficiency with business intelligence tools, preferably Power BI (report development, data modeling, DAX basics)
  • Experience with Jira for backlog management, story writing, and sprint tracking
  • Strong documentation skills with experience in Confluence or similar knowledge management platforms
  • Excellent written and verbal communication skills in English, with the ability to facilitate conversations between technical and non-technical stakeholders across time zones
  • Experience working in globally distributed teams with daily cross-timezone collaboration
  • Analytical mindset with strong attention to detail and the ability to identify data quality issues and requirements gaps
  • Self-directed with the ability to manage multiple concurrent workstreams and competing priorities

 

Preferred Qualifications

 

          Healthcare payer domain experience: claims data (837/835), provider contracts, fee schedules, reimbursement methodologies, or pricing analytics

          Experience with healthcare data systems such as QNXT, Facets, or similar claims adjudication platforms

          Familiarity with ETL/ELT pipeline concepts and data warehouse architecture (enough to have informed conversations with engineers, not to build pipelines)

          Experience with data governance concepts, including data lineage, data quality frameworks, and PHI handling

          Experience supporting edits, audits, or cost containment workstreams in a healthcare payer or consulting context

          Agile certification (CSM, CSPO, or SAFe) or demonstrated experience in Scrum or Kanban delivery models

          Experience with Python for data analysis or automation (not required, but a plus)

          Bachelor’s degree in Business, Healthcare Administration, Information Systems, or a related field (or equivalent practical experience)

 

Benefits

  • Flexible Paid Time Off of up to 23 days annually, in addition to 10 paid public holidays
  • Hybrid work model with flexible in-office attendance
  • Comprehensive health benefits including medical insurance (Mediclaim), personal accident insurance, and term life insurance
  • Generous paid parental leave program
  • Attractive employee referral bonus scheme
  • Transportation allowance and night shift allowance
  • Employee advance salary loan facility
  • Structured professional certification reimbursement policy to support ongoing learning and development

 

We put humans at the center of our work 

  

We’re a global management and technology consulting firm specializing in strategic profitability improvement, digital transformation, and strategy & change for clients. Our cross-industry solutions are powered by a digital-first mindset, market intelligence, and data-driven approach to deliver purposeful change, actionable insights, and guaranteed results.

  

But what sets us apart is our people. We are guided by our deeply embedded guiding principles: Excellence, Passion, Loyalty to Clients, Stewardship, Family, Community, Sustainability, and Inclusion.  

  

And we’ve been recognized as a top firm to work for by companies like Forbes, Top Workplaces Chicago Tribune, and Consulting Magazine.  

  

We’ve earned a Great Place to Work Certification™ and been named a World’s Best Management Consulting Firm by Forbes, Vault’s Top 50 Firms to Work For, Crain's Chicago Business Fast 50, Inc 5000’s Fastest Growing Firms, and Consulting Magazine's Fastest Growing Firms.  

 

Learn more about our award-winning culture 

  

 AArete, LLC (“AArete”) may utilize Artificial Intelligence/Automated Decision-Making Technology/Automated Employment Decision Technology tools and resources (“AI” or “tools” or “resources”) to assist humans in generating job descriptions and postings, recruitment, analyzation of information, screening candidates, evaluation of candidate information, and assisting humans in the selection of potential candidates by all levels of AArete employees for all positions.

 

AArete may use Microsoft Co-Pilot, OpenAI ChatGPT, Anthropic Claude, Google Gemini, LinkedIn Recruiter AI and Hiring Assistant, Jobvite Talent Fit and AArete HireSense. AArete may use all the information you provide. Submission of information to AArete shall serve as consent to AArete’s use of AI tools and resources. AArete complies with all applicable law and does not use AI to discriminate against any individual and does not use location or geographic data like zip codes to act in a discriminatory or illegal manner. Your personal data may be used in relation to prospective employment with AArete and will only be retained for so long as legally necessary.

 

AArete shall comply with its posted privacy policies and candidates may contact Recruiting or Privacy Departments, as identified below, to request accommodations or to exercise any of your applicable rights, pursuant to applicable law:  

 

Recruiting: recruiting@aarete.com

 

Privacy: privacy@aarete.com    

 

We are an Equal Employment Opportunity Employer 

  

All qualified applicants will receive consideration for employment without regard to race, color, religion, sex, sexual orientation, gender identity, national origin, disability, or status as a protected veteran. 

 

#LI-DNI

Location & Eligibility

Where is the job
Pune, India
On-site at the office
Who can apply
Open to applicants worldwide

Listing Details

Posted
April 8, 2026
First seen
May 6, 2026
Last seen
July 31, 2026

Posting Health

Days active
101
Repost count
0
Trust Level
15%
Scored at
August 16, 2026

Signal breakdown

freshnesssource trustcontent trustemployer trust
Newsletter

Stay ahead of the market

Get the latest job openings, salary trends, and hiring insights delivered to your inbox every week.

A
B
C
D
Join 12,000+ marketers

No spam. Unsubscribe at any time.

aareteBusiness Systems Analyst- Payment Intelligence