aarete2mo ago

Business Systems Analyst- Payment Intelligence

India·Punemid

Business Systems AnalystBusiness Analysis & Process

3 views0 saves0 applied

Apply Now

Quick Summary

Overview

Business Systems Analyst AArete is one-of-a-kind when it comes to consulting firm culture. We’re a global, innovative management and technology consulting firm with offices in the U.S., India, and Europe.

Key Responsibilities

We are hiring a Business Systems Analyst to join our team within the Data Architecture & Engineering practice. You will serve as the bridge between business stakeholders and the engineering team - translating healthcare payer business requirements…

Requirements Summary

4+ years of experience as a Business Analyst, Business Systems Analyst, or similar role in a data-intensive environment Strong SQL skills with the ability to write queries for data exploration, validation, and analysis in Snowflake or similar cloud…

Technical Tools

confluencejirapower-bipythonsnowflakesqlagiledata-analysisdatabase-designetl

A black and orange circle with black textDescription automatically generated

Business Systems Analyst

AArete is one-of-a-kind when it comes to consulting firm culture.

We’re a global, innovative management and technology consulting firm with offices in the U.S., India, and Europe. Our name comes from the Greek word for excellence: “Areté.” And excellence is exactly what we strive for.

We’re celebrating our fourth year as one of Forbes’ World’s Best Management Consulting Firms – and our success starts with our people. From robust career development planning to competitive life and wellness benefits, AArete’s “Culture of Care” takes a holistic approach to the employee experience.

AAretians (our team members) are leaders at every level. You are encouraged to unlock your full potential by directly contributing to our mission and prioritizing personal development and fulfillment.

The Role

This role is deeply embedded in the delivery process. You will work across edits development, contract configuration, fee schedule ingestion, and reporting workstreams to define requirements, document acceptance criteria, validate output, and ensure that what gets built matches what the business needs. You are not writing code, but you need to understand how data pipelines, Snowflake, and healthcare claims data work well enough to have credible technical conversations with engineers.

Work You’ll Do

Gather, analyze, and document business requirements from US-based consulting teams, project managers, and client delivery leads for workstreams including edits development, contract configuration, and fee schedule automation
Translate business requirements into detailed technical specifications, user stories, and acceptance criteria that data engineers can execute against
Partner with data engineers to clarify requirements during development, review output against specifications, and validate that deliverables meet business intent
Develop and maintain data dictionaries, business rules documentation, and process flow diagrams for data pipelines and analytics
Support the edits acceptance process by defining test scenarios, validating edits logic output against expected results, and triaging defects with the engineering team
Analyze healthcare claims data in Snowflake to support requirements definition, data quality investigation, and business rule validation
Create and maintain Power BI reports and dashboards that support delivery tracking, edit performance monitoring, and client reporting
Document and maintain process workflows, standard operating procedures, and runbooks in Confluence
Participate in sprint planning, backlog grooming, and sprint reviews as the voice of business requirements within the engineering team
Identify gaps, inconsistencies, and risks in requirements and proactively raise them with stakeholders before they become engineering problems
Other duties as assigned

Requirements

4+ years of experience as a Business Analyst, Business Systems Analyst, or similar role in a data-intensive environment
Strong SQL skills with the ability to write queries for data exploration, validation, and analysis in Snowflake or similar cloud data warehouses
Experience writing detailed technical requirements, user stories, and acceptance criteria for data engineering or software development teams
Proficiency with business intelligence tools, preferably Power BI (report development, data modeling, DAX basics)
Experience with Jira for backlog management, story writing, and sprint tracking
Strong documentation skills with experience in Confluence or similar knowledge management platforms
Excellent written and verbal communication skills in English, with the ability to facilitate conversations between technical and non-technical stakeholders across time zones
Experience working in globally distributed teams with daily cross-timezone collaboration
Analytical mindset with strong attention to detail and the ability to identify data quality issues and requirements gaps
Self-directed with the ability to manage multiple concurrent workstreams and competing priorities

Preferred Qualifications

Healthcare payer domain experience: claims data (837/835), provider contracts, fee schedules, reimbursement methodologies, or pricing analytics
Experience with healthcare data systems such as QNXT, Facets, or similar claims adjudication platforms
Familiarity with ETL/ELT pipeline concepts and data warehouse architecture (enough to have informed conversations with engineers, not to build pipelines)
Experience with data governance concepts, including data lineage, data quality frameworks, and PHI handling
Experience supporting edits, audits, or cost containment workstreams in a healthcare payer or consulting context
Agile certification (CSM, CSPO, or SAFe) or demonstrated experience in Scrum or Kanban delivery models
Experience with Python for data analysis or automation (not required, but a plus)
Bachelor’s degree in Business, Healthcare Administration, Information Systems, or a related field (or equivalent practical experience)

Benefits

Flexible Paid Time Off of up to 23 days annually, in addition to 10 paid public holidays
Hybrid work model with flexible in-office attendance
Comprehensive health benefits including medical insurance (Mediclaim), personal accident insurance, and term life insurance
Generous paid parental leave program
Attractive employee referral bonus scheme
Transportation allowance and night shift allowance
Employee advance salary loan facility
Structured professional certification reimbursement policy to support ongoing learning and development

We put humans at the center of our work

We’re a global management and technology consulting firm specializing in strategic profitability improvement, digital transformation, and strategy & change for clients. Our cross-industry solutions are powered by a digital-first mindset, market intelligence, and data-driven approach to deliver purposeful change, actionable insights, and guaranteed results.

But what sets us apart is our people. We are guided by our deeply embedded guiding principles: Excellence, Passion, Loyalty to Clients, Stewardship, Family, Community, Sustainability, and Inclusion.

And we’ve been recognized as a top firm to work for by companies like Forbes, Top Workplaces Chicago Tribune, and Consulting Magazine.

We’ve earned a Great Place to Work Certification™ and been named a World’s Best Management Consulting Firm by Forbes, Vault’s Top 50 Firms to Work For, Crain's Chicago Business Fast 50, Inc 5000’s Fastest Growing Firms, and Consulting Magazine's Fastest Growing Firms.

Learn more about our award-winning culture

We are an Equal Employment Opportunity Employer

All qualified applicants will receive consideration for employment without regard to race, color, religion, sex, sexual orientation, gender identity, national origin, disability, or status as a protected veteran.

#LI-DNI