Aircall5mo ago

Senior Software Engineer Electron

SpainRemotePermanent Full Time Employeesenior

Software EngineerSoftware Engineering

1 views0 saves0 applied

Apply Now

Quick Summary

Overview

Aircall is a unicorn, AI-powered customer communications platform used by 22,000+ companies worldwide to drive revenue, resolve issues faster, and scale customer-facing teams. We’re redefining customer communications by bringing voice, SMS, WhatsApp, and AI together into one seamless workspace.

Technical Tools

anthropicawscypressgitlab-cijavascriptplaywrighttypescriptci-cdmentoring

Our momentum comes from a simple idea: help teams work smarter, not harder. Aircall’s AI Voice Agent automates routine calls, AI Assist streamlines post-call work, and AI Assist Pro delivers real-time guidance so people can do their best work. The result is higher revenue, faster resolutions, and teams that scale with confidence.

Aircall is headquartered in Paris, our European HQ, with a strong North American presence anchored in Seattle, our North American HQ, and teams across Madrid, London, Berlin, San Francisco, New York City, Sydney, and Mexico City. We’ve built a product customers love and a business that’s scaling quickly, backed by world-class investors and driven by rapid AI innovation across multiple product lines.

At Aircall, you’ll join a company in motion. We’re ambitious, product-driven, and execution-focused, with visible impact, fast decisions, and real growth.

How we work at Aircall: We’re customer-obsessed, data-driven, and focused on delivering meaningful outcomes. We value ownership, continuous learning, and thoughtful speed. If you thrive in a collaborative, fast-moving environment where trust and impact matter, you’ll feel at home here.

We are looking for an engaged and passionate Senior Software Engineer to join our Workspace team as our Desktop Specialist.

Aircall’s flagship product, the Workspace, is primarily used as a desktop application. You will be the owner of this native wrapper, responsible for the design, build, and release pipeline of our Electron application. You will bridge the gap between our web application and the operating system, ensuring a native-grade experience for our customers.

Best practices, evangelization, and mentoring will be part of your day-to-day job. Quality, excellence, and agility drive our delivery processes.

Own the lifecycle of our desktop app. You will manage publishing to app stores, code signing, notarization, and safe auto-updates for our global user base.

Design and maintain robust CI pipelines (GitLab CI). You will implement automated testing strategies for Electron, collaborating with our staff QA engineer, to prevent regressions before they reach production.

Safely navigate major version bumps of Electron and Chromium, anticipating breaking changes and managing the impact on device management and memory usage.

Debug and optimize the application’s performance, focusing on memory leaks and CPU usage in a desktop environment, critical for maintaining a high audio quality during calls.

Maintain and extend native integrations with USB telephony hardware (Jabra, Plantronics, Yealink headsets) for call control and presence features.

Participate in an on-call rotation to respond to critical system issues.

Electron 35+ (actively tracking latest stable releases)

electron-builder for multi-platform packaging (NSIS, MSI, Squirrel installers)

electron-updater for safe, differential auto-updates across our global user base

Vite for fast builds and hot module replacement during development

TypeScript for type-safe main and preload processes

Node.js native modules (node-hid) for USB hardware integration

GitLab CI for automated builds, code signing, and release pipelines

AWS for build artifact distribution and crash reporting

RxJS for reactive event handling

Code signing: @electron/notarize (Mac), custom esigner.js (Windows)

Modern developer experience with AI-assisted development (Cursor, Claude), fast CI/CD, type-safe workflows

We maintain installers for both macOS (signed, notarized, hardened runtime) and Windows (NSIS, MSI with per-machine installs).

You have at least 5+ years of experience, with deep expertise in Electron and the Node.js ecosystem.

You have proven experience building and maintaining CI/CD pipelines (GitLab CI preferred) for desktop applications.

You know the ins and outs of code signing (Apple/Windows) and auto-update mechanisms.

You have experience establishing E2E testing strategies for desktop applications using tools like Playwright or Cypress.

You stay current with modern development practices and tooling, including AI-assisted development tools, to maximize your productivity.

You are rigorous about security and understand the implications of browser versions and third-party dependencies.

You prefer robust, automated solutions over manual processes.

You are autonomous and capable of delivering complex infrastructure projects on time.

Location & Eligibility

Where is the job

Spain

Remote within one country

Who can apply

Open to applicants worldwide

Listed under

Spain

Listing Details

Posted: November 25, 2025
First seen: March 26, 2026
Last seen: May 14, 2026

Posting Health

Days active: 48
Repost count: 0
Trust Level: 39%
Scored at: May 14, 2026

Signal breakdown

freshnesssource trustcontent trustemployer trust

Apply for this position

Aircall

lever

We believe in the power of conversation. We want to empower Sales & Supports teams to truly connect with customers, bring meaning to a conversation, and create long-lasting business impact.

Employees

750

Founded

2014

Domain

Jobs

External application · ~5 min on Aircall's site

Please let Aircall know you found this job on Jobera.