Capco
Capco1mo ago

Business Analyst-Data

India - Bengalurumid
Business AnalystData & AI
2 views0 saves0 applied

Quick Summary

Overview

Job: BA-Risk About Us:- Joining Capco means joining an organization that is committed to an inclusive working environment where you’re encouraged to #BeYourselfAtWork. We celebrate individuality and recognize that diversity and inclusion, in all forms, is critical to success.

Key Responsibilities

Support the discovery, documentation, and analysis of “as is” Business Intelligence/ Reporting across both organizations, including pain points, hand-offs and data sources (and gaps) Facilitate workshops with SMEs to validate process understanding…

Requirements Summary

Strong experience in Business Analysis within transformation, process change, operational improvement, or integration programmes. Proven ability to capture and document complex processes clearly and at varying levels of detail.

Technical Tools
dbtsnowflakesqlagiledata-analysisetl

Job: BA-Risk

 About Us:-
Joining Capco means joining an organization that is committed to an inclusive working environment where you’re encouraged to #BeYourselfAtWork. We celebrate individuality and recognize that diversity and inclusion, in all forms, is critical to success. It’s important to us that we recruit and develop as diverse a range of talent as we can. We believe that everyone brings something different to the table – so we’d love to know what makes you different.

We are/have:
Experts in banking and payments, capital markets and wealth and asset management
Deep knowledge in financial services offering, including e.g., Finance, Risk and Compliance, Financial Crime, Core Banking etc.
Committed to growing our business and hiring the best talent to help us get there Focused on maintaining our nimble, agile and entrepreneurial culture.

“Capco, a Wipro company, is a global technology and management consulting firm. Awarded with Consultancy of the year in the British Bank Award and has been ranked Top 100 Best Companies for Women in India 2022 by Avtar & Seramount. With our presence across 32 cities across globe, we support 100+ clients across banking, financial and Energy sectors. We are recognized for our deep transformation execution and delivery. 

WHY JOIN CAPCO?
You will work on engaging projects with the largest international and local banks, insurance companies, payment service providers and other key players in the industry. The projects that will transform the financial services industry.

MAKE AN IMPACT
Innovative thinking, delivery excellence and thought leadership to help our clients transform their business. Together with our clients and industry partners, we deliver disruptive work that is changing energy and financial services.

#BEYOURSELFATWORK
Capco has a tolerant, open culture that values diversity, inclusivity, and creativity.

CAREER ADVANCEMENT
With no forced hierarchy at Capco, everyone has the opportunity to grow as we grow, taking their career into their own hands.

DIVERSITY & INCLUSION
We believe that diversity of people and perspective gives us a competitive advantage.

Job: BA Data
Domain: Insurance
India – Bangalore/Pune/Hyderabad/Gurgaon/Chennai/Mumbai
Experience: 7+ Years
Job Description:

Role Purpose:

    • Skills Required: Technical Skills

      1. Data Analysis and Querying. Must be comfortable working directly with data to answer business questions. SQL, DBT and Snowflake (ideal)
      2. Business Intelligence Tools. Must be able to present insights clearly and intuitively QLIK (ideal)
      3. Data Modelling & Metrics Logic. Must understand how business concepts map to data structures (Conceptual and logical data modelling, defining business rules for calculations and metrics (metric standardization, working with star schemas or curated analytics layers
      4. Understanding of Data Platforms & Architecture. Must understand how data flows. (Data warehouses and lakes, ETL / ELT concepts, Source systems, latency constraints
      5. Requirements & Documentation Skills (Technical). Strong documentation covering (i) Writing clear analytical requirements, (ii) Data dictionaries and metric definitions, (iii) Process flows and business logic documentation and (vi) Translating business questions into analytical specifications

       

      Key Responsibilities

      Support the discovery, documentation, and analysis of “as is” Business Intelligence/ Reporting across both organizations, including pain points, hand-offs and data sources (and gaps)

      Facilitate workshops with SMEs to validate process understanding and uncover integration issues (disparate data sources, data gaps, tactical fixes, measurement assumptions) and/or optimization opportunities (data integration opportunities)

      Produce clear process artefacts (process maps, data flows, procedure notes, RACI updates) in line with Aviva process design and governance standards.

      Support the definition of future state “to be” Business Intelligence/ Reporting – via requirements gathering - aligned to integration objectives , regulatory requirements, and business strategy. .

      Perform data mapping exercises across two different organizations to map their Data/ Fields to a common data dictionary

      Provide recommendations for integrating data into a common target to provision ‘to be’ reporting from.

      Contribute to reporting, RAID management, and progress tracking for the integration workstream.

       

      Skills & Experience

      Strong experience in Business Analysis within transformation, process change, operational improvement, or integration programmes.

      Proven ability to capture and document complex processes clearly and at varying levels of detail.

      Skilled facilitator able to engage stakeholders from multiple teams and ability partner with the business to understand requirements.

      Experience working with process frameworks, methodologies, and tooling (e.g., BPMN, Lean, SIPOC, Visio, Systems Thinking).

      Solid understanding of risk, control, compliance, and governance considerations in process design.

       

      Behaviours

      Curious, structured, and detail driven.

      Able to work with ambiguity and provide clarity.

      Collaborative and relationship focused.

      Proactive, organised, and delivery driven.

       

WHY JOIN CAPCO?

You will work on engaging projects with some of the largest banks in the world, on projects that will transform the financial services industry.
We offer:

A work culture focused on innovation and creating lasting value for our clients and employees.
Ongoing learning opportunities to help you acquire new skills or deepen existing expertise.
A flat, non-hierarchical structure that will enable you to work with senior partners and directly with clients.
A diverse, inclusive, meritocratic culture

Location & Eligibility

Where is the job
India - Bengaluru
On-site at the office
Who can apply
Same as job location

Listing Details

Posted
May 15, 2026
First seen
May 15, 2026
Last seen
June 10, 2026

Posting Health

Days active
26
Repost count
0
Trust Level
31%
Scored at
June 10, 2026

Signal breakdown

freshnesssource trustcontent trustemployer trust
Capco
Capco
greenhouse

Capco, a Wipro company, is a global technology and management consultancy specializing in driving digital transformation in the financial services and energy sectors.

Employees
5k+
Founded
1998
Domain
capco.com
View company profile
Newsletter

Stay ahead of the market

Get the latest job openings, salary trends, and hiring insights delivered to your inbox every week.

A
B
C
D
Join 12,000+ marketers

No spam. Unsubscribe at any time.

CapcoBusiness Analyst-Data