Chime
Chime~1mo ago

Senior Frontend Engineer, Design Systems

EngineeringData ScienceOtherFrontend EngineeringSenior Frontend EngineerSystems Design Engineer
4 views0 saves0 applied

Quick Summary

Overview

About the role We are looking for a Senior Front-End Engineer to join our Design Systems and play a key role in helping evolve our core foundations across products.

Technical Tools
graphqlreacttypescriptfintechmobile-dev

About the Role

~1 min read

We are looking for a Senior Front-End Engineer to join our Design Systems and play a key role in helping evolve our core foundations across products. 

As the senior front-end engineer, you will collaborate with a team of experienced engineers and designers to create innovative solutions focused on the underlying system that powers our user experiences — from tokens and typography to color, patterns, and component architecture.

You will also have the opportunity to shape the roadmap for our internal applications and mobile app, driving impactful projects from concept to completion. Working closely with product managers, operations teams, and other engineering teams, you'll influence the design and functionality of the experience that all of our members use every day.

The base salary offered for this role and level of experience will begin at $164,000 and up to $227,000. Full-time employees are also eligible for a bonus, competitive equity package, and benefits. The actual base salary offered may be higher, depending on your location, skills, qualifications, and experience. 

  • Exercise technical leadership for high-impact projects 
  • Advocate for and implement best practices in UX development, ensuring a seamless and consistent user experience across all our applications
  • Implement product features and provide support or work with backend engineers to define and integrate platform APIs
  • Mentor, document, and share knowledge as part of your immediate team as well as through Chime Engineering as a whole
  • Foster collaboration across engineering teams to create reusable, scalable solutions, contributing to architecture blueprints that benefit the entire organization.
  • Lead projects by defining timelines, managing scope, overseeing development, and ensuring quality
  • Contribute to a culture of continuous improvement by actively participating in sprint ceremonies and process refinement
  • Participate in a community of practice (guild) around how our frontend ecosystem is architected, developed, tested, deployed, and released. Foster the community’s creativity, innovation, and learning. 
  • Engineers are required to participate in on-call rotation. Being on call may include responding to incidents outside of regular working hours when necessary.
  • Deep knowledge and ability to navigate all aspects of front-end development, with 6+ years of active web and/or mobile development experience with React, React Native and Typescript
  • Demonstrated ability to be a team player as well as a top-level individual contributor in a cross-functional environment, collaborating with engineers, designers and product managers
  • Work across the stack (React Native, Native iOS/Android, GraphQL API, CI/Build systems) 
  • Familiarity with modern front-end build pipelines and tooling and web front end technologies and frameworks
  • Strong communication skills, with the ability to articulate design decisions and rationale
  • Desire to drive engineering culture within your immediate team, as well as within the larger organization
  • Strong leadership skills and the ability to work with cross-functional partners to define requirements, manage scope, and execute on software projects
  • Proficiency in writing thorough and effective tests for your code, including unit tests and integration tests, along with experience in rolling out features through a gradual process, closely monitoring their impact and scaling up through a slow ramp to ensure stability and performance.

#LI-Hybrid #LI-AA1

At Chime, we believe that everyone can achieve financial progress. We created Chime—a financial technology company, not a bank*—on the premise that core banking services should be helpful, easy, and free. Through our user-friendly tools and intuitive platforms, we empower our members to take control of their finances and work towards their goals. Whether it's starting a savings account, purchasing a first car or home, launching a business, or pursuing higher education, we're proud to have helped millions unlock their financial potential.

We're a team of problem solvers, dreamers, and builders with one shared obsession: our members. From day one, Chimers have worked tirelessly to out-hustle and out-execute competitors to bring our mission to life. Their grit and determination inspire us to work harder every day to deliver the very best experience possible. We each bring an owner's mindset to our work, refusing to be outdone and holding ourselves accountable to meet and exceed the highest bars for our teams, our company, and our members.

We believe in being bold, dreaming big, and taking risks, while also working together, embracing our diverse perspectives, and giving each other honest feedback. Our culture remains deeply entrepreneurial, encouraging every Chimer to see themselves as stewards of our mission to help everyday Americans unlock their financial progress. 

We know that to achieve our mission, we must earn and keep people's trust—so we hold ourselves to the highest standards of integrity in everything we do. These aren't just words on a wall—our values are embedded in every aspect of our business, serving as a north star that guides us as we work to help millions achieve their financial potential.

Because if we don't—who will?

*Chime is a financial technology company, not a bank. Banking services provided by The Bancorp Bank, N.A. or Stride Bank, N.A., Members FDIC.

What We Offer

~3 min read
🏢 Our in-office work policy is designed to keep you connected - with four days a week in the office and Fridays from home for those near one of our offices, plus team and company-wide events depending on location. Whether you’re coming in regularly or are part of our fully remote program, you’ll stay engaged with your work and teammates.
💻 In-office perks including backup child, elder, and/or pet care, plus a subsidized commuter benefit to support your regular commute
💰 Competitive salary based on experience
✨ 401k match plus great medical, dental, vision, life, and disability benefits
🏝 Generous vacation policy and company-wide Chime Days, bonus company-wide paid days off
🫂 1% of your time off to support local community organizations of your choice
👟 Annual wellness stipend to use towards eligible wellness related expenses
👶 Up to 24 weeks of paid parental leave for birthing parents and 12 weeks of paid parental leave for non-birthing parents
👪 Access to Maven, a family planning tool, with $15k lifetime reimbursement for egg freezing, fertility treatments, adoption, and more.
🎉 In-person and virtual events to connect with your fellow Chimers—think cooking classes, guided meditations, music festivals, mixology classes, paint nights, etc., and delicious snack boxes, too!
💚 A challenging and fulfilling opportunity to join one of the most experienced teams in FinTech and help millions unlock financial progress

Location & Eligibility

Where is the job
New York, United States
On-site at the office
Who can apply
US
Listed under
United States

Listing Details

First seen
March 26, 2026
Last seen
May 18, 2026

Posting Health

Days active
52
Repost count
0
Trust Level
31%
Scored at
May 18, 2026

Signal breakdown

freshnesssource trustcontent trustemployer trust
Chime
Chime
greenhouse

We’re changing the way people feel about banking.

Employees
750
Founded
2013
Domain
chime.com
View company profile
Newsletter

Stay ahead of the market

Get the latest job openings, salary trends, and hiring insights delivered to your inbox every week.

A
B
C
D
Join 12,000+ marketers

No spam. Unsubscribe at any time.

ChimeSenior Frontend Engineer, Design Systems