Ebanx
Ebanx3mo ago

Senior Software Engineer

BrazilBrazil·Curitiba,Curitibasenior
OtherSoftware EngineerSoftwareSoftware Engineering
4 views0 saves0 applied

Quick Summary

Overview

EBANX is one of the most successful fintechs to emerge from Latin America — and today, we are building a truly global payments company. Our mission has remained constant from day one: to unlock access and enable companies and consumers to participate in the digital economy, no matter where they are.

Technical Tools
awsdatadogelasticsearchmysqlnew-relicphpslacksqltableauagilecode-reviewconcurrencydistributed-systemstdd

EBANX is one of the most successful fintechs to emerge from Latin America — and today, we are building a truly global payments company. Our mission has remained constant from day one: to unlock access and enable companies and consumers to participate in the digital economy, no matter where they are.

What started as a bold vision has grown into a platform that connects some of the world’s largest digital businesses with customers across 21 of the fastest-growing markets. We operate where complexity exists — turning local challenges into global opportunities, and building the infrastructure that allows payments to move further, faster, and smarter.

We are a team of builders and problem-solvers. We think globally, act with curiosity, and believe diversity of thought is a competitive advantage.

As EBANX enters its next phase of hyper growth, we are looking for people who want to shape the future of payments, expand what’s possible, and help connect businesses and consumers across borders.
Let’s build what’s next — together.

 

At EBANX’s Engineering team, you don’t just write code. You turn ideas into scalable solutions that ensure excellence and reliability for millions of global transactions. Every line of code contributes to the digital payments revolution, combining innovation, collaboration, and real impact to make our work truly Out Of The Ordinary.

  • Writing and testing code in an incremental, agile and well-documented way;
  • Doing thorough code-reviews and help your teammates with complex designs and architectural decisions;
  • Testing and following your code to production continuously;
  • Developing new tools to help facilitate all of your team's work;
  • Interacting with colleagues from different departments like Product, Finance, Risk and Business Development;
  • Working on strategic projects for EBANX;
  • Evolving and deciding the future of our payments platform;
  • A system of high availability (+ 99.9%) and with high throughput (100+ TPS), written in PHP, and MySQL (yes, it is possible :smile:). Don't know PHP? No problems, the important thing is to master the basics!
  • Proven experience designing, implementing and deploying software solutions to production; the stack is not relevant, we are ready to teach it to new teammates if necessary;
  • Interest in subjects such as data structures, concurrency, persistence and distributed systems;
  • Expertise in git or any other collaborative version control system;
  • A vision for software quality, evolution of systems, decomposition of problems and abstractions;
  • A great ability to learn new practices, technologies, programming languages and absorbing engineering culture;
  • Passion for software, you go to sleep and wake up thinking about how to make that part of the system more elegant or efficient;
  • Advanced English, we have customers from all around the world and it is commonplace for us to speak and write English when helping, supporting and writing specifications with them;
  • Software development expertise in any complementary area to our core business, such as: data warehouses, specialized development platforms, infrastructure automation, services provisioning, real-time systems, fault tolerant systems and mission critical systems;
  • Experience with deploying to and monitoring a cloud infrastructure especially AWS.
  • Experience with computer networks, latency, package loss, routing optimization, monitoring and problem solving;
  • Full knowledge of SQL and relational databases;
  • Test driven development: you don't even remember how to code without a very extensive test coverage; You often write the tests first and then the code.
  • Expertise in at least one functional or logic programming language -- besides SQL ;)
  • Comfortable with challenges of concurrency problems and has already worked in distributed and asynchronous systems;
  • Knowledge of data replication and conciliation;
  • Sustainable work pace: 40 hours a week of an accelerated but not frenetic rhythm - no marathons or sleepless nights; The focus is on working smarter.
  • The best tools money can buy so you can be productive in your work; (Macbook, Jetbrains licenses, Slack, Github, TravisCI, NewRelic, DataDog, ElasticSearch, Kibana, Tableau amongst others)
  • Deep and fast code reviews for any of your pull requests - You will also do a lot of them :)
  • Constant discussions about our practices and systems, everybody that wants to speak out is always heard and we are always open to new ideas, practices and tools;
  • You will be free to dedicate part of your time to improve our systems and implement quality features that make us more efficient or less error prone;
  • Frequent, fair and transparent performance evaluations - all developers are evaluated with the same system and have access to the same career development opportunities;
  • Performance Bonus: Annual bonus program based on company results.
  • Meal Allowance: Monthly allowance to support your meals.
  • EBANX Education: Financial assistance for undergraduate, graduate, and MBA programs to support your professional growth.
  • EBANX Skills: Dedicated budget for courses, certifications, and workshops to encourage continuous learning.
  • Language Classes: Language classes to support your personal and professional development.
  • Health & Well-being: Medical and dental plans with extensive coverage, including support for dependents and wellness programs.
    Flexible Work Culture: Semi-flexible hours, additional day off on your birthday, and year-end break to support work-life balance.
  • Well-being Program: Access to activities and resources that promote physical and mental health.

 

Learn more about our #ebanxlife on LinkedIn and Instagram, and see what it’s like to be part of a global team that breaks barriers, creates opportunities, and celebrates every achievement together.

✨ An Out Of The Ordinary career is waiting for you here!

Location & Eligibility

Where is the job
Curitiba, Brazil
On-site at the office
Who can apply
BR
Listed under
Worldwide

Listing Details

Posted
April 8, 2026
First seen
April 8, 2026
Last seen
July 8, 2026

Posting Health

Days active
100
Repost count
0
Trust Level
29%
Scored at
July 18, 2026

Signal breakdown

freshnesssource trustcontent trustemployer trust
Ebanx
Ebanx
greenhouse

EBANX is a premier payment services provider empowering global companies to successfully engage in emerging markets through localized payment solutions.

Employees
750
Founded
2012
Domain
ebanx.com
View company profile
Newsletter

Stay ahead of the market

Get the latest job openings, salary trends, and hiring insights delivered to your inbox every week.

A
B
C
D
Join 12,000+ marketers

No spam. Unsubscribe at any time.

EbanxSenior Software Engineer