Emburse5mo ago

Software Engineer III - Front end (Javascript/Typescript)

Toronto,TorontoFull-Timemid

Frontend EngineeringSoftware EngineerSoftware Engineering

3 views0 saves0 applied

Apply Now

Quick Summary

Overview

About the Company At Emburse our mission is to help make our users’ lives – and their businesses – better. We are dramatically transforming how organizations manage corporate expenses and invoices.

Technical Tools

angularawsazurejavascriptmysqlreactsqltypescriptvueagiledocumentationroadmap-planning

About the Company

At Emburse our mission is to help make our users’ lives – and their businesses – better. We are dramatically transforming how organizations manage corporate expenses and invoices. We humanize work by automating manual tasks and saving users’ time, so they can focus on what matters most – their family, community, or more rewarding work. We help CFO’s give their employees a simple and amazing experience while ensuring compliance and reducing costs. Our solutions are tailored for companies from start-ups and SMBs to enterprises such as Microsoft, Pinterest, Bosch, Bill & Melinda Gates Foundation, and Estee Lauder. We have more than 18,000 customers and 12 million users globally.

Emburse software engineers contribute to the development of an engaging and interconnected set of system solutions. As an engineer, you will enhance the experiences of your customers, solve interesting challenges, and design new solutions. Emburse, known for its innovation and award-winning technologies, is strong on engineering. This ensures you will have access to the best and brightest minds in our industry to grow your experience and career within Emburse.

Technical

Self-sufficient in at least one large area of the codebase

Mastery of at least one language and developing mastery of multiple other languages, frameworks and tools

Identifies viable alternative solutions and presents them

Understanding of relational databases, development frameworks, and commonly used industry libraries.

Understanding of testing and integration testing techniques

Moderate understanding of how a handful of key sub-systems interoperate

Ability to read and understand existing code and offer recommendations for improvement

Understanding of OWASP

Process

SDLC processes are followed, including adopting agile-based processes/meetings, peer code-reviews, and technical preparations required for scheduled releases.

Understands product roadmap and how one contributes to the overall objectives

Capability of prioritizing tasks

Estimates their own work

Learns and applies secure software development practices, reviews code for vulnerabilities and raises awareness of secure programming practices

Impact

Fixes bugs of moderate complexity and demonstrates proficient debugging skills

Reviews code for team members, providing in-depth comments

Develops new features or enhancements with minimal supervision

Delivers medium level refactoring

Implements unit testing and integration testing where needed

Produces quality technical documentation

Makes technical documentation/knowledge base contributions and technical team presentations

Communication

Gives constructive feedback to team members

Understanding of industry jargon and business concepts

Raises roadblocks and updates estimations as needed

Bachelor’s degree in Computer Science or related field, or equivalent years’ experience

Required: Minimum of 4 years of software development experience

Professional experience building web applications in React, Angular or a similar framework

Professional experience with SQL and relational database management systems (e.g. MySQL)

Experience working with source control (e.g. Git)

Experience designing and building JSON or REST services and APIs

Experience working with 3rd party APIs, workflow and integration architectures

Experience with cloud service providers (e.g. AWS, Azure)

Experience building web applications with Vue.js, React, Angular or a similar framework

Professional experience with Sass, and/or PostCSS

Knowledge of common CSS methodologies (BEM, ITCSS, OOCSS, Utility First)

Experience with modern JavaScript syntax (promises, async/await, rest/spread)

Experience with front end build tools (Webpack, Rollup, Gulp)

Location & Eligibility

Where is the job

Toronto

Hybrid — some on-site time required

Who can apply

Same as job location

Listed under

Worldwide

Listing Details

Posted: December 1, 2025
First seen: March 26, 2026
Last seen: May 8, 2026

Posting Health

Days active: 42
Repost count: 0
Trust Level: 33%
Scored at: May 8, 2026

Signal breakdown

freshnesssource trustcontent trustemployer trust

Apply for this position

Emburse

lever

Emburse humanizes work by empowering business travelers, finance professionals and CFOs to eliminate manual, time-consuming tasks so they can focus on what matters most.

Employees

750

Founded

2020

Domain

Jobs

External application · ~5 min on Emburse's site

Please let Emburse know you found this job on Jobera.