Hypebeast
Hypebeast5mo ago

Software Engineer - PHP, JavaScript

Hong KongHong KongFull-timemid
Software EngineerSoftware Engineering
8 views0 saves0 applied

Quick Summary

Overview

Hypebeast is a leading global platform for contemporary culture and lifestyle, and a premier destination for editorially-driven news and commerce. Founded in 2005, it became a publicly listed company in 2016, and today boasts a global readership across North America, Asia Pacific, Europe and more.

Technical Tools
awselasticsearchjavascriptlaravelmysqlphptypescriptvueapi-designdatabase-designecommerce
Hypebeast is a leading global platform for contemporary culture and lifestyle, and a premier destination for editorially-driven news and commerce. Founded in 2005, it became a publicly listed company in 2016, and today boasts a global readership across North America, Asia Pacific, Europe and more. The Group has expanded its publishing brands to a wider scope, encompassing Hypebeast and its multiple content distribution platforms, creative agency Hypemaker, and e-commerce and retail platform HBX. 
 
We’re hiring a Mid-Senior Software Engineer (Full Stack) to own and evolve our e-commerce platform. This is a domain-heavy role where you’ll build business-critical capabilities end-to-end—from product discovery to checkout to post-purchase workflows—while integrating with our app team and ERP systems.
  • Backend: PHP (Symfony)
  • Frontend: JavaScript, TypeScript (Vue 3), SCSS
  • Data: MySQL, Elasticsearch
  •  
    You’ll thrive here if you care about engineering craft, take full ownership after release, and can operate with high autonomy.
  • Build and maintain end-to-end features across backend and frontend (design → implementation → release → support).
  • Develop and extend Sylius/Symfony modules with strong domain modeling, correctness, and maintainability.
  • Build and maintain Vue-based UI components and front-end architecture.
  • Design and maintain APIs used by: Native mobile apps (Android/iOS) and the app engineering team; E-commerce operations systems (e.g., Odoo); Internal services as needed
  • Improve search and product discovery via Elasticsearch (relevance, performance, indexing workflows).
  • Own quality: write and maintain tests, validate edge cases, and keep integration contracts reliable.
  • Troubleshoot production issues when needed, identify root causes, and reduce recurring incidents.
  • 2+ years shipping production web systems end-to-end.
  • Solid backend fundamentals in PHP with modern framework (Symfony, Laravel or similar); Sylius experience is highly valued.
  • Practical frontend experience with Typescript and Vue 3 (component architecture, real-world UI delivery).
  • Strong working knowledge of MySQL or similar (schema design, query performance).
  • Hands-on experience using ElasticSearch in real products.
  • Own quality end-to-end: implement automated tests (unit/integration/API; e2e are widely adopted), and verify changes before release.
  • High autonomy: you proactively clarify requirements, propose solutions, and drive delivery with stakeholders.
  • Strong English communication (spoken and written). Cantonese is a plus.
  • Experience working with ERP platforms (especially e-commerce operations workflows and understanding finance/accounting requirements).
  • Experience working within a retail or e-commerce business environment (domain knowledge of inventory, promotions, logistics, etc.).
  • Mobile-facing API design experience (versioning, backward compatibility, performance).
  • Experience with AWS and production observability (logging/metrics/tracing).
  • Experience designing reliable systems, combined with effective use of AI coding agents to speed up development without compromising code quality or maintainability.
  • The team is lean — successful candidates are highly self-directed.
  • End-to-end ownership: you’re accountable for outcomes after release.
  • High autonomy & proactivity: you move work forward with minimal hand-holding.
  • Stakeholder engagement: you can work directly with product, operations, and app teams.
  • Quality first: clean code, pragmatic architecture, and reliable tests.
  • If you think you’ve got what it takes, please provide your cover letter, CV and expected salary.
     
    This position is based and located in Hong Kong. Candidate must be eligible to work in Hong Kong.
     
    Personal data collected is for recruitment purposes only.
     
    ---

    Location & Eligibility

    Where is the job
    Hong Kong
    On-site within the country
    Who can apply
    HK
    Listed under
    Hong Kong

    Listing Details

    Posted
    January 22, 2026
    First seen
    March 26, 2026
    Last seen
    July 11, 2026

    Posting Health

    Days active
    107
    Repost count
    0
    Trust Level
    31%
    Scored at
    July 11, 2026

    Signal breakdown

    freshnesssource trustcontent trustemployer trust
    Hypebeast

    Hypebeast Ltd, founded in 2005, is a leading platform for contemporary culture and lifestyle, expanding from a sneaker blog into a multi-faceted media and e-commerce company.

    Employees
    350
    Founded
    2005
    View company profile
    Newsletter

    Stay ahead of the market

    Get the latest job openings, salary trends, and hiring insights delivered to your inbox every week.

    A
    B
    C
    D
    Join 12,000+ marketers

    No spam. Unsubscribe at any time.

    HypebeastSoftware Engineer - PHP, JavaScript