Hypebeast3mo ago

Software Engineer - PHP, JavaScript

Hong KongFull-timemid

Software EngineerSoftware Engineering

6 views0 saves0 applied

Apply Now

Quick Summary

Overview

Technical Tools

awselasticsearchjavascriptlaravelmysqlphptypescriptvueapi-designdatabase-designecommerce

Hypebeast is a leading global platform for contemporary culture and lifestyle, and a premier destination for editorially-driven news and commerce. Founded in 2005, it became a publicly listed company in 2016, and today boasts a global readership across North America, Asia Pacific, Europe and more. The Group has expanded its publishing brands to a wider scope, encompassing Hypebeast and its multiple content distribution platforms, creative agency Hypemaker, and e-commerce and retail platform HBX.

We’re hiring a Mid-Senior Software Engineer (Full Stack) to own and evolve our e-commerce platform. This is a domain-heavy role where you’ll build business-critical capabilities end-to-end—from product discovery to checkout to post-purchase workflows—while integrating with our app team and ERP systems.

Backend: PHP (Symfony)

Frontend: JavaScript, TypeScript (Vue 3), SCSS

Data: MySQL, Elasticsearch

You’ll thrive here if you care about engineering craft, take full ownership after release, and can operate with high autonomy.

Build and maintain end-to-end features across backend and frontend (design → implementation → release → support).

Develop and extend Sylius/Symfony modules with strong domain modeling, correctness, and maintainability.

Build and maintain Vue-based UI components and front-end architecture.

Design and maintain APIs used by: Native mobile apps (Android/iOS) and the app engineering team; E-commerce operations systems (e.g., Odoo); Internal services as needed

Improve search and product discovery via Elasticsearch (relevance, performance, indexing workflows).

Own quality: write and maintain tests, validate edge cases, and keep integration contracts reliable.

Troubleshoot production issues when needed, identify root causes, and reduce recurring incidents.

2+ years shipping production web systems end-to-end.

Solid backend fundamentals in PHP with modern framework (Symfony, Laravel or similar); Sylius experience is highly valued.

Practical frontend experience with Typescript and Vue 3 (component architecture, real-world UI delivery).

Strong working knowledge of MySQL or similar (schema design, query performance).

Hands-on experience using ElasticSearch in real products.

Own quality end-to-end: implement automated tests (unit/integration/API; e2e are widely adopted), and verify changes before release.

High autonomy: you proactively clarify requirements, propose solutions, and drive delivery with stakeholders.

Strong English communication (spoken and written). Cantonese is a plus.

Experience working with ERP platforms (especially e-commerce operations workflows and understanding finance/accounting requirements).

Experience working within a retail or e-commerce business environment (domain knowledge of inventory, promotions, logistics, etc.).

Mobile-facing API design experience (versioning, backward compatibility, performance).

Experience with AWS and production observability (logging/metrics/tracing).

Experience designing reliable systems, combined with effective use of AI coding agents to speed up development without compromising code quality or maintainability.

The team is lean — successful candidates are highly self-directed.

End-to-end ownership: you’re accountable for outcomes after release.

High autonomy & proactivity: you move work forward with minimal hand-holding.

Stakeholder engagement: you can work directly with product, operations, and app teams.

Quality first: clean code, pragmatic architecture, and reliable tests.

Location & Eligibility

Where is the job

Hong Kong

On-site within the country

Who can apply

Listed under

Hong Kong

Listing Details

Posted: January 22, 2026
First seen: March 26, 2026
Last seen: May 11, 2026

Posting Health

Days active: 45
Repost count: 0
Trust Level: 31%
Scored at: May 11, 2026

Signal breakdown

freshnesssource trustcontent trustemployer trust

Apply for this position

Hypebeast

lever

Hypebeast Ltd, founded in 2005, is a leading platform for contemporary culture and lifestyle, expanding from a sneaker blog into a multi-faceted media and e-commerce company.

Employees

350

Founded

2005

Domain

Jobs

External application · ~5 min on Hypebeast's site

Please let Hypebeast know you found this job on Jobera.