J
Jobscan 229d ago
TWD 1500000–2000000/yr

Senior Full-Stack Software Engineer

TaiwanTaiwan·TaipeiRegular Full-timesenior
OtherSoftware EngineerFull Stack Software EngineerSoftware Engineering
5 views0 saves0 applied

Quick Summary

Overview

At Jobscan, we’re passionate about empowering job seekers to land more interviews with AI. We have helped millions of job seekers get more interviews in 100+ countries. Jobscan’s platform benefits job seekers, employers, universities, and communities. We're a fast-growing startup 🚀.

Technical Tools
dockerelasticsearchlaravelmysqlphpvuea11yab-testingci-cdfrontend-performanceperformance-optimizationsaas
At Jobscan, we’re passionate about empowering job seekers to land more interviews with AI. We have helped millions of job seekers get more interviews in 100+ countries. Jobscan’s platform benefits job seekers, employers, universities, and communities. We're a fast-growing startup 🚀. Since its founding in 2014, Jobscan has thrived for 11 years as a 100% self-funded company, achieving consistent profitability and rapid growth without VC investment. Recently, we’ve transformed into an AI-first company, leveraging cutting-edge tools to enhance operations and our product. This independence allows us to stay laser-focused on our customers, delivering impactful solutions for job seekers. Join us if you wish to be a part of a company that makes a real difference in people’s lives ❤️!

About the Role

~1 min read

We’re hiring a senior Full-Stack Engineer focused on Growth to work on Jobscan, a multi-domain SaaS product helping job seekers optimize resumes using data, rules-based logic, and AI.

This is an end-to-end ownership role across product and marketing surfaces. You’ll build and optimize systems that drive user acquisition, activation, and conversion - spanning landing pages, SPA UI, APIs, and infrastructure - then iterate based on data.

A product-minded engineer who can turn ambiguous growth problems into measurable, shipped improvements. You should:

  • Make strong trade-offs between speed, quality, and cost
  • Be comfortable running experiments and iterating quickly
  • Understand how technical decisions impact conversion, SEO, and user behavior
  • Communicate clearly in English and Mandarin
  • Build and optimize high-impact user flows (landing → signup → activation → conversion)
  • Instrument and run A/B tests and experiments to drive measurable improvements
  • Optimize performance and Core Web Vitals (LCP, CLS, INP)
  • Improve SEO performance (rendering strategy, structured data, crawlability, indexing)
  • Manage and tune CDN, caching, and edge delivery (e.g., Cloudflare)
  • Work on marketing surfaces (e.g., WordPress, landing pages) to increase organic traffic and conversion
  • Diagnose issues across SSR/prerendering, caching, and bot vs user behavior
  • Own and ship end-to-end growth features across frontend (Vue SPA), backend APIs (Laravel/PHP), and infrastructure
  • Integrate external services (analytics, AI, payments) where needed
  • Debug and resolve production issues across frontend, backend, and infrastructure
  • Continuously improve CI/CD, observability, and performance efficiency
  • 5+ years building production web applications
  • Strong full-stack fundamentals (frontend + backend)
  • Experience with:
  • Frontend: Vue (or similar SPA frameworks)
  • Backend: Laravel (or similar)
  • Database: MySQL (or relational databases)
  • Experience with SEO, performance optimization, or growth engineering
  • Experience running or supporting A/B testing / experimentation
  • Experience with CDN, caching, and browser performance optimization
  • Experience with Docker / containerized environments
  • Proven ability to make sound technical trade-offs
  • Strong product mindset - focused on user and business outcomes
  • Experience working on high-traffic SEO pages (100k+ monthly visits)
  • WordPress (custom plugins, performance optimization)
  • Experience with Elasticsearch (or similar search systems)
  • Experience with analytics tools (e.g., PostHog)
  • Experience modernizing or migrating legacy systems
  • Familiarity with web accessibility standards (WCAG, VPAT) and shipping accessible UI
  • You consistently ship measurable growth improvements
  • You identify and fix conversion leaks and performance bottlenecks
  • You design experiments and learn quickly from data
  • You improve systems while moving fast
  • You turn ambiguous growth problems into shipped solutions
  • You identify bottlenecks in how we build and ship, and implement fixes that improve velocity and reliability.
  • Benefits
    ・Remote-friendly - we trust you to get your work done and make it to your meetings, though our roles in Taiwan may involve semi-regular coworking sessions in the Xinyi District for better collaboration with the local team
    ・Competitive salary - you should have a piece of what we're building here
    ・Flexible schedule - we make it easy to take care of what matters, whether that's family, health, or life outside of work; though you might expect some early morning meetings to accommodate our other time zones (6:30 am being the earliest)
    ・Unlimited PTO - we want our employees to have time to care for their personal wellness and mental health
    ・Paid maternal/parental leave - enjoy time with your family's new addition👩‍🍼👨‍👩‍👧
    ・$1000 office stipend
    ・Monthly education, internet stipend and wellness stipend (use for yoga class, gym membership, or anything that improves your personal wellness🧘‍♀️)

    Location & Eligibility

    Where is the job
    Taipei, Taiwan
    Hybrid — some on-site time required
    Who can apply
    TW
    Listed under
    Taiwan

    Listing Details

    Posted
    April 23, 2026
    First seen
    April 23, 2026
    Last seen
    May 22, 2026

    Posting Health

    Days active
    29
    Repost count
    0
    Trust Level
    37%
    Scored at
    May 23, 2026

    Signal breakdown

    freshnesssource trustcontent trustemployer trust
    Newsletter

    Stay ahead of the market

    Get the latest job openings, salary trends, and hiring insights delivered to your inbox every week.

    A
    B
    C
    D
    Join 12,000+ marketers

    No spam. Unsubscribe at any time.

    J
    Senior Full-Stack Software EngineerTWD 1500000–2000000