Paystack
Paystack3mo ago

Technical Financial Crime Manager

NigeriaNigeria·Lagosmid
OtherManager
9 views0 saves0 applied

Quick Summary

Overview

Technical Financial Crime Manager About Paystack Over the past nine years, Paystack has established itself as a pioneer in African fintech with a mission to help merchants get paid by anyone, anywhere in the world.

Key Responsibilities

Technical Ownership of Detection & Monitoring Define, build, test, and optimise fraud and AML detection rules, scenarios, thresholds, and models used in production systems.

Technical Tools
bigquerydbtmongodbmysqlnumpypandaspostgresqlpythonscikit-learnsnowflakesqldata-analysisetlfintechforecastingmachine-learningperformance-managementsystem-design

Over the past nine years, Paystack has established itself as a pioneer in African fintech with a mission to help merchants get paid by anyone, anywhere in the world. Processing over $300 million in monthly transactions, our modern payments infrastructure supports tens of thousands of notable corporations, including MTN, Bolt, and Domino’s Pizza.

As we enter a phase of accelerated growth, we are seeking a Technical Financial Crime Manager to own, design, and scale our fraud and AML detection capabilities. This role sits at the intersection of data, engineering, and financial crime operations, with end-to-end accountability for ensuring our monitoring systems are technically robust, domain-accurate, and scalable across multiple markets.

This is a hands-on technical leadership role. You will define detection logic, guide system design, and directly influence how financial crime risk is identified and managed at Paystack, while also leading and developing high-performing fraud and AML teams.

Responsibilities

~1 min read

As the Technical Financial Crime Manager, you will run the day-to-day fraud and AML detection stack; from data and rules to operational outcomes. You will combine deep technical expertise with financial crime domain knowledge to design effective monitoring systems, manage domain specialists, and ensure Paystack remains a safe, trusted payments platform.

You will be accountable for:

  • The technical quality and effectiveness of fraud & AML monitoring logic
  • The operating model and performance of Financial Crime Monitoring teams
Technical Ownership of Detection & Monitoring
  • Define, build, test, and optimise fraud and AML detection rules, scenarios, thresholds, and models used in production systems.
  • Translate complex datasets and domain insights into actionable detection logic embedded in monitoring and alerting platforms.
  • Establish feedback loops between investigation outcomes and detection logic to continuously improve signal quality.
  • Measure and manage detection performance using quantitative metrics (precision, recall, false positives, alert-to-case conversion, loss metrics).

Requirements

~1 min read
Data Analysis, Modelling & Insights
  • Analyse large, complex transactional and behavioural datasets to identify emerging fraud and AML risks across markets.
  • Design and implement statistical models, machine learning approaches, and/or time-series analysis to enhance detection capabilities.
  • Build and own dashboards and reporting frameworks tracking KPIs, SLAs, alert quality, investigator productivity, and risk outcomes.
Financial Crime Oversight
  • Own the end-to-end fraud and AML detection domain, ensuring alignment between prevention, detection, investigation, and remediation.
  • Apply deep understanding of fraud typologies, AML/CTF risks, sanctions, and regulatory expectations to detection design.
  • Manage the Fraud and AML operational teams (specialists and first-line managers) to ensure adequate coverage, capability and day-to-day execution. 
  • Translate regulatory, partner, and audit requirements into scalable technical and operational controls.
  • Stay ahead of evolving financial crime patterns, market-specific risks, and regulatory developments across Paystack’s footprint.
Tooling, Automation & Scale
  • Partner with Product and Engineering to embed detection logic into core systems and improve monitoring, alerting, and case management tooling.
  • Drive automation initiatives to reduce manual effort, improve consistency, and enable scale without compromising control quality.
  • Identify and prioritise enhancements to monitoring platforms, workflows, and data pipelines.
  • Ensure fraud and AML tooling evolves in line with transaction growth, new products, and new markets.
  • Build and continuously improve operational processes, SLAs, KPIs, and quality frameworks across Fraud and AML teams.
  • Use data and metrics to manage performance, capacity, and outcomes, ensuring teams operate efficiently and effectively.
  • Identify gaps, risks, and inefficiencies, leading initiatives to strengthen controls and scale operations sustainably.
  • Balance speed, quality, regulatory expectations, and customer experience in day-to-day decision-making.
Cross-Functional & Executive Collaboration
  • Work closely with Product, Engineering, Data, Risk, Compliance, Legal, and Customer Operations. 
  • Influence roadmap priorities related to fraud, AML, and financial crime tooling.
  • Provide clear updates to senior stakeholders on operational performance, risks, and emerging issues
Required 
  • 7+ years in financial crime roles in payments, fintech, banking, or financial services.
  • Strong technical expertise in data analysis, including advanced SQL and experience working with large, complex datasets.
  • Expert Python skills, including experience with libraries such as pandas, NumPy, scikit-learn, statsmodels, and/or model pipelines.
  • Proven experience designing, building, and tuning risk detection systems (fraud, AML, or similar).
  • Solid understanding of statistical modelling, machine learning, and/or time-series forecasting, with experience deploying models into production or operational workflows.
  • Ability to translate data insights into operational detection logic used by investigators and automated systems.
  • Experience measuring and optimising detection performance using quantitative metrics.
  • Deep understanding of financial crime typologies, fraud patterns, AML/CTF requirements, and regulatory obligations.
  • Experience operating within fraud, AML, risk, or compliance functions in payments, fintech, or financial services.
  • Proven experience leading and developing teams, including setting direction, coaching, and performance management.
  • Ability to balance technical depth with practical operational decision-making.
  • Excellent communication skills, with the ability to explain complex technical concepts to non-technical stakeholders.

Nice to Have

~1 min read
  • Experience with dbt and modern analytics stacks.
  • Experience with version control systems (GitHub).
  • Experience with AI-assisted tooling or advanced analytics platforms.
  • Familiarity with monitoring platforms, alerting systems, transaction screening, and case management tools.
  • Experience working with OLTP (MySQL/PostgreSQL/SQL Server), OLAP (Redshift/BigQuery/Snowflake), and NoSQL (MongoDB) databases.
  • Industry certifications such as ACAMS, ICA, CFE, CFCS, or similar.

This role is foundational to Paystack’s ability to scale safely. You will define how financial crime detection works at Paystack, combining strong technical systems with sound domain judgment. Success in this role directly protects customers, merchants, partners, and the broader financial ecosystem while enabling Paystack’s continued growth across Africa and beyond.

This role is open to candidates based in Nigeria, Ghana, Kenya, or South Africa

Location & Eligibility

Where is the job
Lagos, Nigeria
On-site at the office
Who can apply
Open to applicants worldwide
Listed under
Nigeria

Listing Details

Posted
March 24, 2026
First seen
March 26, 2026
Last seen
June 24, 2026

Posting Health

Days active
90
Repost count
0
Trust Level
23%
Scored at
June 25, 2026

Signal breakdown

freshnesssource trustcontent trustemployer trust
Paystack
Paystack
greenhouse
Employees
125
Founded
2015
View company profile
Newsletter

Stay ahead of the market

Get the latest job openings, salary trends, and hiring insights delivered to your inbox every week.

A
B
C
D
Join 12,000+ marketers

No spam. Unsubscribe at any time.

PaystackTechnical Financial Crime Manager