Smithrx
Smithrx~2mo ago
↻ Repost

Senior Staff Data Engineer

Remotesenior
OtherData EngineeringData EngineerStaff Data EngineerData & AI
3 views0 saves0 applied

Quick Summary

Key Responsibilities

Architecture & Technical Strategy Define Technical Vision: Define the long-term data engineering strategy guided by company-wide priorities and engineering best practices.

Technical Tools
airflowcppcsharpdbtjavalookerpythonscalasnowflakesparksqldata-analysisdatabase-designdistributed-systemsetlmachine-learning

SmithRx is a rapidly growing, venture-backed Health-Tech company.  Our mission is to disrupt the expensive and inefficient Pharmacy Benefit Management (PBM) sector by building a next-generation drug acquisition platform driven by cutting edge technology, innovative cost saving tools, and best-in-class customer service.  With hundreds of thousands of members onboarded since 2016, SmithRx has a solution that is resonating with clients all across the country.

We pride ourselves for our mission-driven and collaborative culture that inspires our employees to do their best work. We believe that the U.S healthcare system is in need of transformation, and we come to work each day dedicated to making that change a reality. At our core, we are guided by our company values:

  • Integrity: Our purpose guides our actions and gives us confidence in the path ahead. With unwavering honesty and dependability, we embrace the pressure of challenging the old and exemplify ethical leadership to create the new.
  • Courage: We face continuous challenges with grit and resilience. We embrace the discomfort of the unknown by balancing autonomy with empathy, and ownership with vulnerability. We boldly challenge the status quo to keep moving forward—always.
  • Together: The success of SmithRx reflects the strength of our partnerships and the commitment of our team. Our shared values bind us together and make us one. When one falls, we all fall; when one rises, we all rise.

On the Data Engineering team, we transform streams of data into insights that solve real-world Pharmacy Benefits Management (PBM) challenges. We empower our Data Analytics and Machine Learning teams to make drug pricing transparent and easy to understand. We deliver business impact by designing, implementing, and maintaining distributed systems to collect, aggregate, and govern pharmaceutical data. We leverage open-source tools like Airflow and DBT built on top of industry-leading data warehouses (e.g., Snowflake), utilize LLMs to optimize workflows, and use Python heavily in our daily work.

Responsibilities

~1 min read
  • 8+ years of years of industrial experience in data engineering with an advanced degree or 12+ years with an undergraduate degree in Computer Science, Information Technology, or a related field. (Start-up and healthcare experience is highly desirable).
  • Demonstrated mastery of data modeling concepts, database design principles, and data warehouse technologies (e.g., Snowflake) through production-grade implementations.
  • Strong skills in PySpark, SQL, and Python are required. Experience in modern object-oriented or compiled languages such as C#/C++, Go, Java, or Scala is a plus.
  • Hands-on experience with leading ETL tools and frameworks (e.g., Apache Spark, Apache Airflow, dbt, Looker, Superset).
  • In-depth experience managing the entire data lifecycle, with direct responsibility for the development, implementation, and production release of complex data processing solutions utilizing distributed systems.
  • A proven track record of making decisions optimized for the wider engineering organization rather than locally optimal outcomes, especially in environments with significant ambiguity.
  • Define Technical Vision: Define the long-term data engineering strategy guided by company-wide priorities and engineering best practices.
  • Design Ecosystems: Create coherent designs across multiple pipelines and API boundaries. Reduce complex concepts to foundational components and simplify infrastructure to lower maintenance costs.
  • Drive Engineering Excellence: Make high-impact technical choices—including "build vs. buy" and framework selections— based on sound reasoning. Review designs to preemptively identify and resolve technical risks.
  • Improve Developer Efficiency: Implement solutions that measurably improve developer efficiency and establish engineering-wide quality and best practices.
  • Deliver at Scale: Roll out major features and systems reliably, including appropriate monitoring, failure domain characterization, and success metric definitions.
  • Align with Business Goals: Leverage a deep understanding of SmithRx’s business strategy to identify group-wide opportunities. Proactively refocus team efforts when projects are off-course or not moving the needle for the business.
  • Manage Data Quality & Governance: Enforce data governance policies (PII/PHI protection, security, compliance) and implement data quality principles to raise the bar for the reliability of data shared internally and externally.
  • Influence Cross-Functionally: Influence the roadmaps of other SmithRx teams. Act thoughtfully and decisively in critical situations, seeking diverse perspectives but ultimately leading decision-making to move priorities forward.
  • Mentor and Develop: Serve as a role model and coach for other engineers, taking into account their unique skills and providing constructive feedback to maximize their impact.
  • Executive Communication: Develop focused messaging and effectively present technical strategies and business cases at the executive level.
  • Champion Organizational Change: Break down silos, build deep cross-functional relationships, and create excitement to drive the adoption of new technologies or processes across the organization.
  • Highly competitive wellness benefits including Medical, Pharmacy, Dental, Vision, and Life Insurance and AD&D Insurance
  • Flexible Spending Benefits 
  • 401(k) Retirement Savings Program 
  • Short-term and long-term disability
  • Discretionary Paid Time Off
  • 12 Paid Company Holidays
  • Wellness Benefits
  • Commuter Benefits 
  • Paid Parental Leave benefits
  • Employee Assistance Program (EAP)
  • Well-stocked kitchen in office locations
  • Professional development and training opportunities

Location & Eligibility

Where is the job
Worldwide
Fully remote, anywhere in the world
Who can apply
Same as job location
Listed under
Worldwide

Listing Details

First seen
March 27, 2026
Last seen
June 15, 2026

Posting Health

Days active
79
Repost count
1
Trust Level
37%
Scored at
June 15, 2026

Signal breakdown

freshnesssource trustcontent trustemployer trust
Smithrx
Smithrx
greenhouse

SmithRx is on a mission to reduce the the complexity and costs of pharmacy benefits with radical transparency and cutting-edge technology.

Employees
750
Founded
2016
View company profile
Newsletter

Stay ahead of the market

Get the latest job openings, salary trends, and hiring insights delivered to your inbox every week.

A
B
C
D
Join 12,000+ marketers

No spam. Unsubscribe at any time.

SmithrxSenior Staff Data Engineer