Veeva
Veeva1mo ago
$90,000 – $140,000/yr

Full Stack Web Developer

Illinois - ChicagoRemoteFull-Timemid
OtherFull Stack DeveloperSoftware EngineeringFull Stack Web Developer
5 views0 saves0 applied

Quick Summary

Overview

Veeva Systems is a mission-driven organization and pioneer in industry cloud, helping life sciences companies bring therapies to patients faster. As one of the fastest-growing SaaS companies in history, we surpassed $3B in revenue in our last fiscal year with extensive growth potential ahead.

Key Responsibilities

As a Full Stack Web Developer on the Veeva Digital Marketing team, you will partner with both backend and frontend developers to build and maintain Veeva.com and its supporting web properties.

Technical Tools
anthropicjavascriptmysqlphpreacttypescriptcode-reviewcustomer-successlinuxrest-apissaas
Veeva Systems is a mission-driven organization and pioneer in industry cloud, helping life sciences companies bring therapies to patients faster. As one of the fastest-growing SaaS companies in history, we surpassed $3B in revenue in our last fiscal year with extensive growth potential ahead.
 
At the heart of Veeva are our values: Do the Right Thing, Customer Success, Employee Success, and Speed. We're not just any public company – we made history in 2021 by becoming a public benefit corporation (PBC), legally bound to balancing the interests of customers, employees, society, and investors.
 
As a Work Anywhere company, we support your flexibility to work from home or in the office, so you can thrive in your ideal environment.
 
Join us in transforming the life sciences industry, committed to making a positive impact on its customers, employees, and communities.

As a Full Stack Web Developer on the Veeva Digital Marketing team, you will partner with both backend and frontend developers to build and maintain Veeva.com and its supporting web properties. You will be responsible for developing, managing, and evolving custom WordPress plugins and themes, translating business requirements into functional site features, managing complex API integrations, and ensuring the technical performance and security of our backend architecture. 
  • Design and develop maintainable site architectures and help determine technical direction for specific business requirements. You will provide accurate estimates for complex builds and collaborate on the long-term roadmap for our web properties.
  • Play a central role in migrating regional WordPress sites into a single multi-site network and aligning regional themes to a parent/child architecture to reduce technical debt and unify the brand.
  • Build and harden integrations between WordPress and internal/external systems via RESTful APIs, ensuring reliable data flow and system integrity.
  • Proactively debug and improve legacy systems. You will monitor and optimize performance, caching, and security, while systematically resolving debug log backlogs.
  • Actively engage with frontend and backend members of the Digital Marketing team, along with other internal stakeholders as necessary to clarify requirements, scope projects, and provide clear technical updates via meetings, tickets, and live communication.
  • Manage a high-volume project and task load, comfortably switching between multiple internal projects daily while maintaining high standards for speed and code quality.
  • Advance our engineering culture by contributing to reusable tools and process improvements while documenting code and participating in knowledge sharing to keep the team aligned.
  • 5+ years of experience engineering large-scale, enterprise WordPress websites.
  • Experience developing custom WordPress plugins and themes.
  • Advanced PHP expertise.
  • Comfortable working within a Wordpress multi-site environment, including localized and multi-lingual sites.
  • Experience with classic Wordpress editor and the modern block editor.
  • Working knowledge of Git for version control (branching, merging, and code reviews).
  • Strong QA mindset, with experience designing systems for site updates that include thorough testing and quality assurance.
  • Working knowledge of complex MySQL database structures, including importing/exporting data and optimizing database queries
  • Experience interacting with RESTful APIs and data formats (JSON, XML).
  • Experience with Wordpress site migrations.
  • You have the self-management skills to operate independently in a fully remote role.\
  • Experience with WPML.
  • Proficiency using the Unix command line and WP-CLI.
  • Broader modern backend and frontend skills (JavaScript, TypeScript, React, Node.js, Bootstrap, HTML, CSS).
  • Experience writing and maintaining unit tests.
  • Experience with AI coding tools such as Gemini CLI or Claude Code.
  • Experience with various caching systems and content-delivery networks.
  • Medical, dental, vision, and basic life insurance
  • Flexible PTO and company paid holidays
  • Retirement programs
  • 1% charitable giving program
  • Base pay: $90,000 - $140,000
  • The salary range listed here has been provided to comply with local regulations and represents a potential base salary range for this role. Please note that actual salaries may vary within the range above or below, depending on experience and location. We look at compensation for each individual and base our offer on your unique qualifications, experience, and expected contributions. This position may also be eligible for other types of compensation in addition to base salary, such as variable bonus and/or stock bonus. 
  • #LI-Remote
    #LI-Associate

    Veeva’s headquarters is located in the San Francisco Bay Area with offices in more than 15 countries around the world.
     
    Veeva is an equal opportunity employer. All qualified applicants will receive consideration for employment without regard to race, color, sex, sexual orientation, gender identity or expression, religion, national origin or ancestry, age, disability, marital status, pregnancy, protected veteran status, protected genetic information, political affiliation, or any other characteristics protected by local laws, regulations, or ordinances. If you need assistance or accommodation due to a disability or special need when applying for a role or in our recruitment process, please contact us at talent_accommodations@veeva.com.

    Location & Eligibility

    Where is the job
    Worldwide
    Fully remote, anywhere in the world
    Who can apply
    Same as job location
    Listed under
    Worldwide

    Listing Details

    Posted
    April 23, 2026
    First seen
    April 23, 2026
    Last seen
    June 11, 2026

    Posting Health

    Days active
    48
    Repost count
    0
    Trust Level
    51%
    Scored at
    June 11, 2026

    Signal breakdown

    freshnesssource trustcontent trustemployer trust
    Veeva
    Veeva
    lever

    Cloud-based software company providing CRM and content management for the global life sciences industry

    Employees
    7k+
    Founded
    2007
    Domain
    veeva.com
    View company profile
    Newsletter

    Stay ahead of the market

    Get the latest job openings, salary trends, and hiring insights delivered to your inbox every week.

    A
    B
    C
    D
    Join 12,000+ marketers

    No spam. Unsubscribe at any time.

    VeevaFull Stack Web Developer$90k–$140k