Wrike
Wrike~1mo ago

PHP Developer

IndiaIndia·Bangaloremid
Software EngineeringPhp Developer
5 views0 saves0 applied

Quick Summary

Overview

Wrike is the most powerful work management platform. Built for teams and organizations looking to collaborate, create, and exceed every day, Wrike brings everyone and all work into a single place to remove complexity, increase productivity, and free people up to focus on their most purposeful work.

Key Responsibilities

Design, develop, and maintain backend services for Wrike’s website, admin panels, and internal tools. Build and enhance components in our CMS and component management system.

Technical Tools
angularanthropicjavascriptlaravelmysqlphpreactsqltypescriptvueagileci-cdcode-reviewmicroservicesperformance-optimizationrest-apis
Wrike is the most powerful work management platform. Built for teams and organizations looking to collaborate, create, and exceed every day, Wrike brings everyone and all work into a single place to remove complexity, increase productivity, and free people up to focus on their most purposeful work.
 
Our vision:  A world where everyone is free to focus on their most purposeful work, together. 
 

About the Role

~1 min read

As a Website Backend Developer at Wrike, you will own the backend development of our global marketing website and related internal tools. Your work will power key customer-facing experiences, enable marketing and business teams to operate efficiently, and directly support Wrike’s growth by ensuring our web infrastructure is scalable, secure, and optimized for performance and SEO.

  • Design, develop, and maintain backend services for Wrike’s website, admin panels, and internal tools.
  • Build and enhance components in our CMS and component management system.
  • Develop and improve internal tools for managing incoming requests from marketing and other business stakeholders.
  • Implement and optimize REST APIs to support website features and integrations.
  • Contribute to SEO-oriented backend solutions that drive traffic and conversion.
  • Proactively identify, propose, and implement technical improvements to increase performance, reliability, and maintainability.
  • Participate in code reviews, ensuring high code quality, consistency, and adherence to best practices.

Requirements

~1 min read
  • Bachelor’s or Master’s degree in Computer Science or a related field.
  • 5+ years of production web development experience.
  • Strong experience with PHP and Laravel (experience with YII2 or Symfony is a plus).
  • Solid understanding of REST APIs, OOP, SQL, and Git.
  • Proven experience working on SEO-oriented web projects.
  • Ability to architect web applications and tools independently, from concept to deployment.
  • Experience developing admin panels or content management systems.
  • Hands-on participation in collaborative code review processes.
  • User experience with advanced AI coding assistants (e.g., Cursor, Claude Code, Codex).
  • Full professional proficiency in English (written and spoken).
  • Experience with modern JavaScript frameworks (Angular, React, Vue), HTTP requests, and TypeScript.
  • Background in performance optimization for high-traffic websites.
  • Practical application of engineering principles such as KISS, DRY, and SOLID in day-to-day work.
  • General understanding of Continuous Integration (CI) processes and pipelines.
  • Excellent interpersonal, written, and verbal communication skills, with the ability to collaborate across all levels of the organization.
  • A team player who contributes to a fun, supportive, and productive team environment.

You will join the Web Team, which is part of Wrike’s Business Development department. The team is organized into two Scrum teams composed of frontend engineers, backend engineers, QA, and designers. You will be a backend developer within one of these cross-functional squads, collaborating closely with marketing, customer-facing, HR, and other internal teams that rely on our websites, web tools, and admin panels. You’ll work in an environment that values openness, collaboration, and continuous improvement.

  • Methodologies: Scrum, with clear goals set via OKRs.
  • Backend: PHP 8.4, Laravel.
  • Frontend/CMS: Twill CMS + Vue.js.
  • Infrastructure: MySQL, Nginx.
  • Additional Services: Several microservices and standalone projects using Node.js.

We combine a modern PHP/Laravel stack with a component-based CMS and a strong focus on SEO, performance, and marketing enablement. This role offers the opportunity to work on high-impact, customer-facing web properties at scale, while also building internal tools that directly empower business teams—giving you a broad scope of influence compared to many traditional backend roles.

What We Offer

~1 min read
18 calendar days of paid vacation (12 days of National & Festival holidays (10 fixed, 2 flexible))
Sick Leave Compensation (5 Paid Uncertified Sick Days)
Menstrual Leave: Twelve (12) days per calendar year. Women employees are eligible for up to 1 day of menstrual leave per month.
Parental Leave: 26 Weeks Maternity / 4 Week Paternity
2 Volunteer Days
Group Medical Insurance (Employees + Dependents)
Term Life Insurance (Rs 50,00,000)
Personal Accident Insurance (Rs 50,00,000)
Monthly Broadband / Internet Reimbursement (INR 1500)
Hybrid Working Model + Complimentary Lunch & Snacks
We’re a team of innovators and creators who solve the complex work problems of today and tomorrow.
 
Hybrid work mode

Wrike is our people, not a place. With 1,000+ employees collaborating across nearly every time zone, we support talent through 10 global hubs — Australia, Costa Rica, Cyprus, Czechia, Estonia, France, India, Ireland, Japan, and the United States — offering flexible ways of working that include remote work, hybrid environments, and co-working spaces across many locations.
 
While flexibility looks different across teams and regions, employees located near certain hubs — particularly in Prague (CZ), Nicosia (CY), Bangalore (IN), and Rennes (FR) — are generally expected to collaborate in person around 2–3 days per week, balancing the flexibility of distributed work with opportunities for in-person collaboration and connection.
💡  Smart: We love what we do, and we’re great at it because this is our domain. Our combined knowledge in this space is unmatched.
💚  Dedicated: We get up every day focused on helping our customers win. We’re committed to helping our teammates win, too!
🤗  Approachable: We're friendly, easy to get along with, considerate, and helpful. 

We believe in ownership at all levels of the organization, by owning workflows from start to finish. Each member of our team is an integral part of this commitment, establishing work as a platform for personal growth and transformation, as well as collective success and growth.

 
Check out our LinkedIn Life Page, Company culture page, Instagram, Wrike Engineering TeamMedium, Meetup.com, Youtube for a feel for what life is like at Wrike. 

Check us out on Glassdoor.

Location & Eligibility

Where is the job
Bangalore, India
On-site at the office
Who can apply
IN
Listed under
Worldwide

Listing Details

First seen
April 3, 2026
Last seen
May 22, 2026

Posting Health

Days active
49
Repost count
0
Trust Level
31%
Scored at
May 23, 2026

Signal breakdown

freshnesssource trustcontent trustemployer trust
Wrike
Wrike
greenhouse

Wrike is the most powerful work management platform that enables organizations to collaborate, create, and exceed their goals every day.

Employees
3k+
Founded
2006
Domain
wrike.com
View company profile
Newsletter

Stay ahead of the market

Get the latest job openings, salary trends, and hiring insights delivered to your inbox every week.

A
B
C
D
Join 12,000+ marketers

No spam. Unsubscribe at any time.

WrikePHP Developer