bunch
bunch2mo ago
New

(Senior) Backend Engineer

SpainSpain·PortugalRemotefull-timesenior
OtherSenior Backend Engineer
0 views0 saves0 applied

Quick Summary

Overview

bunch is building the backbone of private markets, combining exceptional expertise, operational excellence, and frictionless technology. The platform enables funds and private investors to seamlessly and securely set up and manage their investment entities.We are looking for a (Senior) Backend…

Technical Tools
awsexceljavascriptkubernetesmysqlnestjsreactspring-bootsqlsveltetypescriptci-cdfintechperformance-optimizationroadmap-planningsystem-design

bunch is building the backbone of private markets, combining exceptional expertise, operational excellence, and frictionless technology. The platform enables funds and private investors to seamlessly and securely set up and manage their investment entities.

We are looking for a (Senior) Backend Engineer who wants to play a pivotal role in growing our business and transforming the private markets industry.

You will be at the core of building the technology that powers bunch. We aim to build something meaningful with high impact, not just write code. We offer you freedom and ownership to build the right solutions and influence the product roadmap.

Responsibilities

~1 min read
  • Design and implement robust, scalable, and secure backend services that solve real customer problems

  • Collaborate with your Product Managers, by actively participating in problem discovery and solution creation by leveraging your technical expertise

  • Work closely with other cross-functional teams to ensure a smooth delivery of new features and improvements

  • Maximize your team’s output by enhancing functionality and proactively addressing technical debt as well as actively contributing to improving collaboration and communication

  • To excel as a member of the Product Development team, you should combine a passion for technology with an entrepreneurial mindset and strong problem-solving skills

  • You are a team player with excellent communication skills and a strong work ethic

  • Proficient in backend development with TypeScript or any strongly typed language, SQL databases Nest.js or similar web/dependency management frameworks (e.g., Spring Boot)

  • Strong understanding of system design principles, scalability, and performance tuning

  • 5+ years of professional experience building backend systems in fast-paced environments

  • Experience with fintech, highly regulated industries, or document processing is a plus

We strive to keep our technology stack as simple and efficient as possible.

  • FusionAuth for authentication

  • Retool for low-code internal frontend solutions

  • Twilio and SendGrid for sending SMS and emails

  • Tally for creating custom forms

  • Become one of the key builders of bunch and architect our go-to-market strategy

  • Take part in a network of people passionate about investment and work closely with the most interesting players in the private market

  • Benefit from working with a diverse mix of talents, unrivaled energy, and team spirit within a culture of inclusion

  • Remote work

  • 28 days of vacation, plus local public holidays

  • A competitive compensation package

  • A great tech and work setup with everything you need

Responsibilities

~1 min read
  • First interview with the People team (30 min): get acquainted with the bunch and to understand if what we’re offering is what you’re searching for

  • Hiring Manager Interview (60 min): this conversation with an Engineering Manager will cover product-focused culture and values, including collaboration, ownership, self-awareness, and quality standards.

  • Technical Interview (60 min): this interview in the form of a technical conversation with two engineers will focus on collaborative problem-solving, starting with open-ended questions and progressing to more specific challenges or short algorithm tasks.

  • Final Round: Meet our VP of Engineering (45 min) to learn about ways of working, vision for bunch, and team culture.

  • Meet-and-Greet (Optional - 30 min) to meet a few members of your future cross-functional team.

bunch is Europe’s leading tech-enabled fund administrator for VC, PE, and alternative assets. By combining AI-powered automation with deep domain expertise, we provide a single source of truth that replaces outdated, fragmented processes, and enables clients to master the entire fund lifecycle.

Private markets are experiencing unprecedented growth; with alternative assets projected to reach $40 trillion by the end of the decade. To power this growth, we have raised €22.8 million to date—including our $15.5M Series A in July 2024—and are accelerating our mission to build the backbone of private markets in Europe.

Founded in 2021 and headquartered in Berlin, bunch has expanded to Amsterdam, London, and Luxembourg, now supporting over 500 investment structures, 150 fund and asset managers, and more than 10,000 investors. As we prepare for our next stage of growth, we are looking for ambitious talent to continue redefining this financial category.

At bunch, we are committed to creating an inclusive environment for all employees because we value and celebrate diversity. We are an equal opportunity employer, which means we do not tolerate discrimination toward any of our applicants or employees.

Location & Eligibility

Where is the job
Portugal, Spain
Remote within one country
Who can apply
ES

Listing Details

Posted
February 24, 2026
First seen
May 6, 2026
Last seen
May 7, 2026

Posting Health

Days active
0
Repost count
0
Trust Level
23%
Scored at
May 6, 2026

Signal breakdown

freshnesssource trustcontent trustemployer trust
Newsletter

Stay ahead of the market

Get the latest job openings, salary trends, and hiring insights delivered to your inbox every week.

A
B
C
D
Join 12,000+ marketers

No spam. Unsubscribe at any time.

bunch(Senior) Backend Engineer