Cresta
Cresta~5mo ago

Software Engineer in Test (Berlin)

GermanyGermany·Berlinmid
OtherSoftware EngineerSoftware Engineer In TestSoftware Engineering
15 views0 saves0 applied

Quick Summary

Overview

Cresta is on a mission to turn every customer conversation into a competitive advantage by unlocking the true potential of the contact center. Our platform combines the best of AI and human intelligence to help contact centers discover customer insights and behavioral best practices, automate…

Key Responsibilities

Design, develop, and execute comprehensive test plans and test cases for new and existing features. Identify ambiguities or gaps in product specifications and propose improvements to ensure testability.

Requirements Summary

BS/MS in Computer Science, Engineering, or equivalent technical experience. 5+ years of experience in software QA within SaaS, preferably in customer engagement or contact center platforms.

Technical Tools
cypressdatadoggrafanaplaywrighttypescriptci-cdmentoringsaas

Cresta unlocks the true potential of the customer experience, turning every conversation into a competitive advantage. Cresta’s unified AI platform combines conversational AI agents, real-time human agent augmentation, and comprehensive conversation intelligence to drive revenue and efficiency gains across every channel. The world’s leading companies, including United Airlines, Cox Communications, and Marriott, use Cresta to power world-class customer experiences every day. 

Born from the Stanford AI Lab, Cresta has raised more than $270 million from the world’s leading investors, including a16z, Greylock, and Sequoia. Cresta’s leadership includes some of the leading minds in AI today. Our CEO, Ping Wu, founded and led Google's Contact Center AI and Vertex AI platforms before joining Cresta to build the future of AI-driven customer experiences.

Over the next few years, AI is going to redefine how people all over the world interact with businesses every day. Come build that future at Cresta.

About the Role

~2 min read

We are seeking a diligent and detail-oriented Software Engineer in Test to join our engineering team in Berlin, Germany. This role will be crucial in ensuring the robustness, scalability, and high quality of our software solutions and will be highly focused on building, expanding, and maintaining our automated testing ecosystem. While strong manual testing instincts are important, this role is designed for someone who will spend the majority of their time writing code, advancing automation, and developing internal tools. The ideal candidate is someone who can independently identify what and how to test, take ownership of impactful projects, and help elevate quality across the organization.

Responsibilities
  • Design, develop, and execute comprehensive test plans and test cases for new and existing features.
  • Identify ambiguities or gaps in product specifications and propose improvements to ensure testability.
  • Automate key scenarios using our Playwright-based test framework (TypeScript), with a focus on reliability and maintainability.
  • Perform manual exploratory testing, particularly for complex, high-impact features or areas with low automation ROI.
  • Analyze and communicate test results, triaging issues with clear, actionable insights.
  • Maintain and evolve testing standards, procedures, and documentation.
  • Set up and manage testing environments to mirror production usage patterns.
  • Investigate customer-reported issues, including log analysis (e.g., from Datadog/Grafana), reproduction steps, and severity assessment.
  • Collaborate with developers and product managers to drive quality from feature design through release.
  • Contribute to release decisions with risk assessments and test coverage summaries.
  • Partner with cross-functional teams to elevate quality across the SDLC.
  • Identify and advocate for opportunities to expand test coverage across the organization.
Qualifications
  • BS/MS in Computer Science, Engineering, or equivalent technical experience.
  • 5+ years of experience in software QA within SaaS, preferably in customer engagement or contact center platforms.
  • Strong track record in creating and executing both manual and automated test strategies.
  • Proficiency in automation frameworks (e.g., Playwright, Cypress) and modern development workflows.
  • Deep understanding of QA methodologies, processes, and CI/CD practices.
  • Attention to detail with a bias toward risk-based testing.
  • Strong problem-solving and debugging skills, including backend and frontend issue investigation.
  • Ability to think like an end-user and test accordingly, especially when product requirements are minimal or evolving.
  • Excellent communication skills and the confidence to constructively advocate for quality.
  • Experience mentoring peers or contributing to testing infrastructure is a plus.

What We Offer

~1 min read

Compensation for this position includes a base salary, equity, and a variety of benefits. Actual salaries will be based on candidate-specific factors, including experience, skills, and location, as well as applicable local minimum pay requirements. We are actively hiring for this role in Berlin. For further details, please consult your recruiter.

We have noticed a rise in recruiting impersonations across the industry, where scammers attempt to access candidates' personal and financial information through fake interviews and offers. All Cresta recruiting email communications will always come from the @cresta.ai domain. Any outreach claiming to be from Cresta via other sources should be ignored.  If you are uncertain whether you have been contacted by an official Cresta employee, reach out to recruiting@cresta.ai

Location & Eligibility

Where is the job
Berlin, Germany
On-site at the office
Who can apply
DE
Listed under
Worldwide

Listing Details

First seen
March 26, 2026
Last seen
August 28, 2026

Posting Health

Days active
154
Repost count
0
Trust Level
31%
Scored at
August 28, 2026

Signal breakdown

freshnesssource trustcontent trustemployer trust
Cresta
Cresta
greenhouse

Experts on Day One®

Employees
30
Founded
2003
View company profile
Newsletter

Stay ahead of the market

Get the latest job openings, salary trends, and hiring insights delivered to your inbox every week.

A
B
C
D
Join 12,000+ marketers

No spam. Unsubscribe at any time.

CrestaSoftware Engineer in Test (Berlin)