I
Insiderone1mo ago

Backend Software Developer (PHP/Laravel) – Remote

TürkiyeRemoteFull-Time (Remote)mid
OtherBackend EngineeringBackend Software Developer
6 views0 saves0 applied

Quick Summary

Overview

Before jumping into all the information about the role and what you can bring to the table, let us introduce ourselves real quick.

Technical Tools
anthropicawsdockerelasticsearchgojavascriptlaravelmysqlphpredisagileb2bci-cdcode-reviewdocumentationmachine-learningrest-apissaas
Before jumping into all the information about the role and what you can bring to the table, let us introduce ourselves real quick.
 
About us
 
Insider One is the #1 platform that brings everything marketing and customer engagement teams need in one place so they can reach their peak potential and become unstoppable. 
 
Our story began with six desks and a vision to create a single platform to make industry-first technologies and emerging channels accessible to marketers worldwide. Today, Insider One is powered by 1,500+ team members representing 50+ nationalities across 30+ offices.  With AI at its core and an integrated Customer Data Platform (CDP), Insider One unites data, personalization, and journey orchestration across the most extensive set of natively supported channels, including WhatsApp, SMS, Email, Web, App, and Site Search. 
 
We recently raised one of the largest funding rounds in the industry, a $500M Series E led by General Atlantic. We are backed by top-notch investors, including Sequoia Capital, QIA, Riverwood, and Endeavor Catalyst, and trusted by 2000+ customers from high-growth startups to the most prestigious Fortune 500 companies such as Samsung, Nike, L’Oreal, Singapore Airlines, Nestlé, Nissan, Lenovo, Puma, IKEA, Allianz, Domino's, and the list goes on.
 
Insider One was congratulated for becoming one of the only woman-founded, women-led B2B SaaS unicorns in the world. Loved by customers, recognized by analysts, we are the only vendor recognized as the #1 leader in all the capabilities marketing and customer engagement teams need. Don’t just take our word for it — see for yourself. We consistently outperform and continue our leadership, and the results speak for themselves.
 
From day one, Insider One’s mission has not only been to build a world-class product company, but also to create one of the most socially progressive technology communities in the world. Through our social responsibility initiatives like 100 Social Responsibility Projects, AI Training for Teachers, Code Academy, SheCodes, SheLeads, and SheMarkables, our community has committed to scaling its impact on our communities across 30+ countries, driving initiatives in health, education, farming, animal rights, and increasing women’s representation in STEM.
 
Behind all these achievements is an exceptionally talented, visionary team of overachievers that moves fast and agile, creating cutting-edge products, and focuses on making an impact. If you want to be a part of this journey, just keep reading.
 
And now? Now we are looking for a Senior Software Engineer, who will help our team create and implement a wide variety of web-based products using PHP and Go or Node.js, and wants to take their career one step further. If you think you are one of those people, here you will have the chance to work with the world's leading brands with Artificial Intelligence & Machine Learning technologies. Right now, while you are reading this, we are sending an average of 2.2 billion requests and almost 2 billion instant notifications to more than 450 servers a day. On the Artificial Intelligence and Predictive side, we have more than 100 TB of historical data. We do not wait for jobs or opportunities to come to our feet, we create them. We have now reached 25% of global users. If all these interests you, read on for more! 
 
Our Engineers and Software Developers always think with an innovative perspective, taking advantage of the inexhaustible power of the digital world. They create impressive and intelligent products like a true artist. Our Product and Development teams are located in our Istanbul and Ankara offices, so we produce and develop the technology we export to the world in our own country. As Insider One, we believe in cooperation and adapting the innovations brought by technology by acting fast. We work closely with other Departments with agile teams, and we are not afraid of getting our hands dirty. As we said; we do not wait for jobs or opportunities to come to our feet, we create them ourselves. You can check our Tech Stacks here!
  • Design, develop, and maintain scalable backend services and RESTful APIs using Laravel within a modular monolith architecture.
  • Build and enhance multi-tenant SaaS features, ensuring proper data isolation and tenant-aware functionality.
  • Write clean, well-tested, and maintainable code following Domain-Driven Design (DDD) principles, including Entities, Repositories, Managers, and DTOs.
  • Collaborate with cross-functional teams to deliver new features and continuously improve existing functionality.
  • Participate in code reviews, providing constructive feedback and maintaining high code quality standards.
  • Work with code quality tools such as PHPStan, Rector, and Pint to ensure codebase consistency and reliability.
  • Optimize database queries and implement caching strategies using Redis to improve performance.
  • Troubleshoot and debug production issues, implementing robust and scalable solutions.
  • Contribute to technical documentation and participate in architectural decisions.
  • Leverage AI-powered development tools to enhance productivity and improve code quality.
  • Have a Bachelor’s degree in Computer Engineering or a related field.
  • Have 3+ years of software development experience.
  • Have strong hands-on experience with Laravel (must-have); familiarity with Symfony is a plus.
  • Have solid PHP knowledge, with experience in modern PHP practices (PHP 8.x features, strict types, readonly classes).
  • Have experience with package-driven development, modular monolith architecture, and Domain-Driven Design (DDD) patterns.
  • Have a good grasp of MySQL and Redis; experience with Elasticsearch or other NoSQL technologies is a plus.
  • Be proficient with Git and familiar with Git workflows, including branching strategies, code reviews, and CI/CD pipelines.
  • Have experience with code quality tools such as PHPStan, Rector, or similar static analysis tools.
  • Have experience contributing to large-scale projects and collaborating effectively within technical teams.
  • Have a level of English proficiency sufficient to analyze and understand technical documentation
  • Experience with AI-powered development tools such as Claude Code, GitHub Copilot, Cursor, or similar AI coding assistants. (Nice to have)
  • Hands-on experience with AWS (EC2, S3, SQS, or similar services). (Nice to have)
  • Hands-on experience with Docker and containerized development environments. (Nice to have)
  • Interest in or exposure to Go (Golang), with motivation to deepen expertise. (Nice to have)
  • Experience with multi-tenant SaaS architectures. (Nice to have)
  • Familiarity with queue systems such as Laravel Horizon or Redis queues. (Nice to have)
  • Enjoy a monthly meal allowance designed to enhance your daily routine.
  • Access comprehensive private health insurance.
  • Feed your curiosity with access to Spotify, LinkedIn Learning, Blinkist, MasterClass, Neoskola, and CloudGuru.
  • Level up with internal trainings covering AI fundamentals, coding, foreign languages, and a wide range of personal development skills.
  • Be part of a diverse team that’s as global as it gets, where every voice is heard and 50+ nationalities build together.
  • Become a Shareowner through our eligibility-based “ESOP” and own a piece of what you build.
  • Help build the team you want to work with and enjoy rewarding referral bonuses.
  • Opportunities to give back to your community through volunteering and purpose-driven social impact projects.
  • From global retreats to team-building activities, expect year-round events that turn into lifelong memories.
  • Get inspired by the greatest minds in the tech industry through events like our Tech & Dev Talks.
  • Work from anywhere in Turkey through our fully remote setup.
  • We aren't just hiring for a position; we are hiring for a mission — a mission to build a lasting legacy that will set the benchmark for the most progressive tech companies out there. 
    To do this, we are looking for exceptional talent to join a community of good-hearted individuals who take high ownership and are relentlessly driven to go the extra mile.
    If this sounds like who you are and where you aspire to be, we are excited to meet you.

    Location & Eligibility

    Where is the job
    Türkiye
    Remote within one country
    Who can apply
    Open to applicants worldwide
    Listed under
    Turkiye

    Listing Details

    Posted
    April 16, 2026
    First seen
    April 17, 2026
    Last seen
    June 10, 2026

    Posting Health

    Days active
    54
    Repost count
    0
    Trust Level
    32%
    Scored at
    June 10, 2026

    Signal breakdown

    freshnesssource trustcontent trustemployer trust
    Newsletter

    Stay ahead of the market

    Get the latest job openings, salary trends, and hiring insights delivered to your inbox every week.

    A
    B
    C
    D
    Join 12,000+ marketers

    No spam. Unsubscribe at any time.

    I
    Backend Software Developer (PHP/Laravel) – Remote