availity
availity1mo ago
New

Client Implementation Data Architect

United StatesUnited StatesRemotemid
OtherImplementation
0 views0 saves0 applied

Quick Summary

Overview

Availity delivers revenue cycle and related business solutions for health care professionals who want to build healthy, thriving organizations. Availity has the powerful tools, actionable insights and expansive network reach that medical businesses need to get an edge in an industry constantly…

Key Responsibilities

Data Architecture & Design Lead the design and implementation of end-to-end data architectures supporting complex client implementations. Develop and maintain conceptual, logical, and physical data models across multiple systems and platforms.

Requirements Summary

Education Bachelor’s Degree in Computer Science, Data Engineering, Information Systems, Engineering, or a related technical discipline, or equivalent professional experience.

Technical Tools
awsconfluencejirams-officemysqlscalasparksqlagiledata-analysisdatabase-designetlhealthtechperformance-optimizationrest-apis

Availity delivers revenue cycle and related business solutions for health care professionals who want to build healthy, thriving organizations. Availity has the powerful tools, actionable insights and expansive network reach that medical businesses need to get an edge in an industry constantly redefined by change.

At Availity, we're not just another Healthcare Technology company; we're pioneers reshaping the future of healthcare! With our headquarters in vibrant Jacksonville, FL, and an exciting office in Bangalore, India, along with an exceptional remote workforce across the United States, we're a global team united by a powerful mission.

We're on a mission to bring the focus back to what truly matters – patient care. As the leading healthcare engagement platform, we're the heartbeat of an industry that impacts millions. With over 2 million providers connected to health plans, and processing over 13 billion transactions annually, our influence is continually expanding.

Join our energetic, dynamic, and forward-thinking team where your ideas are celebrated, innovation is encouraged, and every contribution counts. We're transforming the healthcare landscape, solving communication challenges, and creating connections that empower the nation's premier healthcare ecosystem.

The Implementation Data Architect (IDA) is a senior, client-facing technical leader responsible for designing, mapping, and implementing complex data architectures that support enterprise-scale client onboarding and information exchange. This role serves as a trusted advisor to clients and internal stakeholders, translating business and functional requirements into scalable, secure, and cloud-native data solutions.

The IDA brings deep expertise in data modeling and cross-model data mapping, strong AWS cloud architecture experience, and hands-on exposure to AI-enabled data solutions. Success in this role requires exceptional presentation and communication skills, particularly when engaging with external clients and executive stakeholders.

Requirements

~1 min read
  • Bachelor’s Degree in Computer Science, Data Engineering, Information Systems, Engineering, or a related technical discipline, or equivalent professional experience.

  • 8+ years of experience in technology, data architecture, information exchange, and/or the healthcare domain.

  • 5+ years of experience leading or architecting complex client implementations and data onboarding initiatives.

  • 3+ years of experience in a senior data architecture or lead data engineering role.

  • Proven experience working directly with external clients in a consultative, client-facing capacity.

  • Expert knowledge of data modeling and cross-model data mapping.

  • Strong proficiency in SQL and enterprise databases (Oracle, MySQL, Aurora, Redshift, or equivalent).

  • Extensive hands-on experience with AWS cloud services and data platforms.

  • Experience with big data and analytics technologies (Spark, Spark SQL, Scala or PySpark).

  • Experience with RESTful APIs and API integration tools such as Postman.

  • Proficiency with Microsoft Office / Office 365 tools.

Requirements

~1 min read
  • AWS certifications (e.g., AWS Solutions Architect, AWS Data Analytics).

  • Experience with AI/ML platforms and services (e.g., SageMaker or equivalent).

  • Familiarity with healthcare interoperability standards such as FHIR and HL7.

  • Prior experience in highly regulated environments.

  • Exceptional presentation and communication skills, both written and verbal.

  • Ability to explain complex technical concepts to non-technical audiences.

  • Strong analytical, problem-solving, and decision-making skills.

  • Self-starter with the ability to work independently in fast-paced, ambiguous environments.

  • Strong organizational skills with the ability to manage multiple complex projects simultaneously.

  • Collaborative mindset with a positive, solution-oriented approach.

Responsibilities

~1 min read
  • Lead the design and implementation of end-to-end data architectures supporting complex client implementations.

  • Develop and maintain conceptual, logical, and physical data models across multiple systems and platforms.

  • Architect and document source-to-target mappings, transformation logic, and data lineage across heterogeneous data models.

  • Ensure data solutions align with scalability, performance, security, and governance best practices.

  • Serve as the primary data architecture lead during client onboarding and implementation engagements.

  • Facilitate client workshops, discovery sessions, and data mapping reviews.

  • Present architecture designs, data flows, and implementation strategies to technical and non-technical client audiences.

  • Act as a trusted technical advisor, clearly articulating design options, trade-offs, and recommendations.

  • Design and implement cloud-native data solutions on Amazon Web Services (AWS).

  • Leverage AWS services such as S3, EMR, Glue, Athena, Redshift, EC2, Lambda, and related components to build scalable data pipelines.

  • Ensure adherence to AWS Well-Architected Framework principles, including security, reliability, and cost optimization.

  • Support production data platforms with monitoring, performance tuning, and operational best practices.

  • Partner with engineering teams to support big data processing using Spark, Spark SQL, and Scala or PySpark.

  • Utilize Jupyter Notebooks for data analysis, validation, and prototyping.

  • Contribute to AI/ML-enabled data initiatives, including data preparation, feature engineering, and integration of AI outputs into downstream systems.

  • Ensure data quality, validation, reconciliation, and governance standards are met.

  • Work with structured and semi-structured data formats including XML, JSON, Parquet, Avro, and custom flat files.

  • Apply healthcare data standards (e.g., FHIR, HL7 where applicable) and best practices for provider data management.

  • Ensure systems and processes comply with HIPAA and healthcare data privacy regulations.

  • Collaborate with stakeholders to define and enforce data governance and security controls.

  • Translate business, functional, and technical requirements into clear and actionable architectural designs.

  • Support Agile delivery processes using Jira and Confluence.

  • Manage multiple complex client implementations in parallel while maintaining quality and delivery timelines.

  • Mentor and guide implementation analysts, data engineers, and junior architects.

What We Offer

~2 min read
Availity is a certified “Great Place to Work”, a “Best Workplaces for Technology Companies”, a “Best Workplaces for Women” and a “Best Workplaces for Millennials”!
Culture is important to us and there are many ways for you to make your mark here!
We have several Diversity & Inclusion teams and various ways to engage with fellow Availity associates. “Availadies”, “Beyond Black”, “HOLA”, “Availity Pride”, “VetAvaility” a Young Professionals Group and “She Can Code IT” a group for women in tech are some of the groups you can get involved in.
Availity is a culture of continuous learning. We have many resources and experts in our tech stack and in our industry that can help get you there too!
We offer a competitive salary, bonus structure, generous HSA company contribution, healthcare, vision, dental benefits and a 401k match program that you can take advantage of on day one!
We offer unlimited PTO for salaried associates + 9 paid holidays. Hourly associates start at 19 days of PTO and go up from there with all the same holiday benefits.
Interested in wellness? We allow our associates to reimburse up to $250/year for gym memberships, participation in racing events, weight management programs, etc.
Interested in furthering your education? We offer education reimbursement!
Availity offers Paid Parental Leave for both moms and dads, both birth parents and adoptive parents.
Availity partners with various organizations, both locally and nationally, to raise awareness, funds and morale as our staff members volunteer their time and funds to engage the organizations campaign.

After you apply, you will receive text/email messages thanking you for applying and then you will continue to receive more text/email messages alerting you as to where you are in the recruitment process.

  • Recruiter Resume Review

  • Manager Resume Review

  • Recruiter Video Interview

  • Panel Video Interview

  • Manager Video Interview

  • Final Video Interview

Video Camera Usage:

Availity fosters a collaborative and open culture where communication and engagement are central to our success.  As a remote first company, we are also camera-first and provide all associates with camera/video capability to simulate the office environment. If you are not able to use your camera for all virtual meetings, you should not apply for this role.

Having cameras on helps create a more connected, interactive, and productive environment, allowing teams to communicate more effectively and build stronger working relationships.  The usage of cameras also enhances security and protects sensitive company information. Video participation is required to ensure that only authorized personnel are present in meetings and to prevent unauthorized access, data breaches, preventing social engineering, or the sharing of confidential information with non-participants.

Availity is an equal opportunity employer and makes decisions in employment matters without regard to race, religious creed, color, age, sex, sexual orientation, gender identity, gender expression, genetic information, national origin, religion, marital status, medical condition, disability, military service, pregnancy, childbirth and related medical conditions, or any other classification protected by federal, state, and local laws and ordinances.

 

Availity is a drug-free workplace. Candidates are required to pass a drug test before beginning employment.

 

NOTICE: Federal law requires all employers to verify the identity and employment eligibility of all persons hired to work in the United States. When required by state law or federal regulation, Availity uses I-9, Employment Eligibility Verification in conjunction with E-Verify to determine employment eligibility. Learn more about E-Verify at http://www.dhs.gov/e-verify.

Click the links below to view Federal Employment Notices.

Family & Medical Leave Act  Equal Employment Law Poster  Pay Transparency  Employee Polygraph Protection Act  IER Right to Work Poster  Important Notice about Employee Rights to Organize and Bargain Collectively with Their Employers

Location & Eligibility

Where is the job
United States
Remote within one country
Who can apply
US

Listing Details

Posted
April 7, 2026
First seen
May 6, 2026
Last seen
May 6, 2026

Posting Health

Days active
0
Repost count
0
Trust Level
21%
Scored at
May 6, 2026

Signal breakdown

freshnesssource trustcontent trustemployer trust
Newsletter

Stay ahead of the market

Get the latest job openings, salary trends, and hiring insights delivered to your inbox every week.

A
B
C
D
Join 12,000+ marketers

No spam. Unsubscribe at any time.

availityClient Implementation Data Architect