Five9
Five9~4mo ago

Sr Software Engineer - Backend Engineer | IND

IndiaIndia·Bangaloresenior
EngineeringOtherBackend EngineeringSoftware EngineerBackend DeveloperSoftware Engineering
8 views0 saves0 applied

Quick Summary

Overview

Join us in bringing joy to customer experience. Five9 is a leading provider of cloud contact center software, bringing the power of cloud innovation to customers worldwide.

Key Responsibilities

Backend Development: Design, develop, and maintain microservices and APIs using .NET Core. Should have a good understanding of .NET Framework. Implement RESTful APIs, ensuring high performance and security.

Requirements Summary

Experience with GraphQL, gRPC, or WebSockets Knowledge of authentication/authorization frameworks (OAuth, JWT, Identity Server) Exposure to serverless architecture and cloud-native best practices Background in automated testing (unit, integration)…

Technical Tools
awsazurecsharpdockergcpgraphqljavascriptkubernetesmongodbreactsnowflakesqltypescriptagileci-cdcode-reviewmicroservicesoauthrest-apis

Join us in bringing joy to customer experience.  Five9 is a leading provider of cloud contact center software, bringing the power of cloud innovation to customers worldwide.   

Living our values everyday results in our team-first culture and enables us to innovate, grow, and thrive while enjoying the journey together. We celebrate diversity and foster an inclusive environment, empowering our employees to be their authentic selves. 

Five9 is a global leader in cloud software for the enterprise contact center market, powering billions of customer interactions annually. Since 2001, Five9 has been at the forefront of the cloud revolution, helping organizations deliver exceptional customer experiences, improve productivity, and achieve measurable business outcomes. 

We are expanding our engineering and delivery teams in Bangalore and are seeking passionate professionals to help design, implement, and scale Five9’s next-generation cloud-native services


We are looking for a highly skilled Full-Stack Developer with expertise in .NET Core, to develop and maintain scalable web applications and microservices. The ideal candidate will have strong problem-solving skills, experience in modern software development, and a passion for creating robust, high-performance applications.


Responsibilities

~1 min read

Backend Development:

  • Design, develop, and maintain microservices and APIs using .NET Core. Should have a good understanding of .NET Framework.
  • Implement RESTful APIs, ensuring high performance and security.
  • Optimize database queries and design schemas for SQL Server / Snowflake / MongoDB.

Software Architecture & DevOps:

  • Design and implement scalable microservices architecture.
  • Work with Docker, Kubernetes, and CI/CD pipelines for deployment and automation.
  • Ensure best practices in security, scalability, and performance.

Collaboration & Agile Development:

  • Work closely with UI/UX designers, backend engineers, and product managers.
  • Participate in Agile/Scrum ceremonies, code reviews, and knowledge-sharing sessions.
  • Write clean, maintainable, and well-documented code.

Requirements

~1 min read
  • 7+ years of experience as a Full-Stack Developer.

  • Strong experience in .NET Core, C#.

  • Proficiency in React.js, JavaScript (ES6+), TypeScript.

  • Experience with RESTful APIs, Microservices architecture.

  • Knowledge of SQL / NoSQL databases (SQL Server, Snowflake, MongoDB).

  • Experience with Git, CI/CD pipelines, Docker, and Kubernetes.

  • Familiarity with Cloud services (Azure, AWS, or GCP) is a plus.

  • Strong debugging and troubleshooting skills


Nice to Have

~1 min read
  • Experience with GraphQL, gRPC, or WebSockets

  • Knowledge of authentication/authorization frameworks (OAuth, JWT, Identity Server)

  • Exposure to serverless architecture and cloud-native best practices

  • Background in automated testing (unit, integration) 


At Five9, we believe that technology is only as powerful as the people behind it. You’ll be part of a team that values collaboration, innovation, and accountability, and you’ll have the opportunity to make a meaningful impact on how global enterprises engage with their customers.

Five9 embraces diversity and is committed to building a team that represents a variety of backgrounds, perspectives, and skills.  The more inclusive we are, the better we are.  Five9 is an equal opportunity employer. 


View our privacy policy, including our privacy notice to California residents here: https://www.five9.com/pt-pt/legal.  

Note: Five9 will never request that an applicant send money as a prerequisite for commencing employment with Five9.

Location & Eligibility

Where is the job
Bangalore, India
On-site at the office
Who can apply
Open to applicants worldwide
Listed under
India

Listing Details

First seen
April 3, 2026
Last seen
August 12, 2026

Posting Health

Days active
131
Repost count
0
Trust Level
31%
Scored at
August 12, 2026

Signal breakdown

freshnesssource trustcontent trustemployer trust
Five9
Five9
greenhouse

Five9 is a leading provider of cloud contact centre software.

Employees
3k+
Founded
2001
Domain
five9.com
View company profile
Newsletter

Stay ahead of the market

Get the latest job openings, salary trends, and hiring insights delivered to your inbox every week.

A
B
C
D
Join 12,000+ marketers

No spam. Unsubscribe at any time.

Five9Sr Software Engineer - Backend Engineer | IND