Kubra
Kubra2mo ago
CAD 95000–115000/yr

Quality Assurance Engineer

CanadaCanada·MississaugaFull-timemid
EngineeringQA & TestingQa EngineerQuality Assurance Lead
3 views0 saves0 applied

Quick Summary

Overview

KUBRA is on the hunt for a Quality Assurance Engineer who’s ready to make an impact 🚀 In this role, you won’t just test software—you’ll help shape the quality of products used by millions.

Technical Tools
csharpcypressjavajavascriptjiramysqlplaywrightsqltypescripta11yagile
  • Act as QA champion on assigned projects.
  • Ensure test plans, test cases, and test execution support timely, high-quality delivery. 
  • Ensure appropriate automated and manual test coverage is maintained based on product priorities and risk.
  • Provide work estimates and complete testing deliverables within agreed timelines.
  • Communicate test results, quality risks, and defects clearly and in a timely manner.
  • Support acceptable service levels during releases and maintenance activities.
  • Design, maintain, and execute test plans and test cases based on business requirements and specifications.
  • Analyze requirements and develop effective testing strategies.
  • Create and maintain automated test coverage for new and existing functionality, including API, UI, regression, and performance testing, based on business priorities and identified risk areas. 
  • Perform functional, system, end-to-end, regression, smoke, data integrity, user acceptance, ad hoc, and manual testing as required. 
  • Review, troubleshoot, and improve unstable automated tests to support reliability and maintainability. 
  • Regress and verify defects, document results, and provide QA metrics. 
  • Build and deploy software across multiple environments.
  • Participate in Agile ceremonies and support maintenance activities as needed. 
  • Assist with feature documentation and provide QA input into use cases, requirements, and acceptance criteria. 

  • Passion for Quality Assurance and a commitment to delivering high-quality, reliable solutions. 
  • Working knowledge of software testing methodologies, SDLC practices, and Quality Assurance fundamentals. 
  • Understanding of programming concepts, best practices, and test automation fundamentals. 
  • Strong troubleshooting, diagnostic, and problem-solving skills, with a willingness to learn and take on technical challenges. 
  • Ability to produce accurate, high-quality work, identify discrepancies, and resolve issues while meeting deadlines. 
  • Knowledge of issue tracking systems such as JIRA. 
  • Ability to design and execute effective tests based on available requirements, specifications, and risk. 
  • High degree of flexibility, adaptability, and creativity. 
  • Ability to work independently in a fast-paced environment with a high degree of professionalism. 
  • Strong organizational, time management, and project coordination skills, with the ability to manage multiple priorities. 
  • Excellent oral and written communication skills, including the ability to communicate effectively with employees and management at all levels. 
  • Ability to remain focused and ensure timelines are met without adversely impacting operations. 
  • Strong work ethic, positive attitude, and ability to thrive in a changing, dynamic environment.
  • 3–5 years of experience in a Quality Assurance or test automation role. 
  • Experience designing, creating, and maintaining automated test cases using tools such as Cypress (preferred), Playwright.
  • Experience developing automated tests using JavaScript/TypeScript (preferred), Java, or C#. 
  • Experience working in Windows and Mac operating systems. 
  • Experience with scripting languages such as Bash or PowerShell. 
  • Experience with source control systems such as Git and issue tracking tools such as JIRA. 
  • Experience testing APIs and web services. 
  • Experience with one or more databases such as SQL, Oracle, or MySQL. 
  • Experience testing web applications across multiple browsers. 
  • Experience with accessibility, security, performance, and automated testing. 
  • Experience testing mobile applications on Android and iOS devices is an asset. 
  • Software development experience is an asset.
  • Thrive in an award-winning culture that champions growth, embraces diversity, and fosters inclusion for all. See our awards →
  • Earn annual performance-based bonuses recognizing your contributions
  • Enjoy generous benefit coverage with low premiums, plus a Healthcare Spending Account and Wellness Spending Account
  • Invest in your future with RRSP matching
  • Take time to recharge with paid vacation and sick days, and enjoy a paid day off for your birthday
  • Make a difference with two paid volunteer days to support causes you care about
  • Keep learning with free access to LinkedIn Learning and our education reimbursement program for continued development
  • Feel appreciated through our employee recognition programs
  • Support your mental health with a free premium Headspace membership
  • Stay refreshed with unlimited access to fully stocked beverage stations
  • Save more with exclusive Perkopolis retail discounts
  • While we value the skills and experiences listed in our job requirements, we also recognize that talent comes in many forms, and welcome applications from candidates who meet most but not all specified requirements. If you possess a strong desire to learn and grow in a dynamic work environment, apply now!
     
    KUBRA is a fast-growing company that delivers customer communications solutions to some of the largest utility, insurance, and government entities across North America. KUBRA offers billing and payments, mapping, mobile apps, proactive communications, and artificial intelligence solutions for customers. With more than 1.5 billion customer interactions annually, KUBRA services reach over 40% of households in the U.S. and Canada. KUBRA is an operating subsidiary of Hearst.
     
    Our office is small enough to allow creative individuals to flourish, yet large enough to provide long-term stability. We place a tremendous amount of responsibility on our team members to be productive, focused and self-motivated. We offer a casual work environment, competitive compensation and a stellar benefits program. 
     
    KUBRA does not typically provide immigration-related assistance, including employment-based work visa (e.g. H-1B) sponsorship, work permit applications and extensions, permanent residence (green card) sponsorship, LMIA applications or permanent residency nominations. Candidates must ensure they have legal authorization to work in the U.S/ Canada. All sponsorship determinations are case by case based on business need.

    Location & Eligibility

    Where is the job
    Mississauga, Canada
    Hybrid — some on-site time required
    Who can apply
    CA
    Listed under
    Canada

    Listing Details

    Posted
    April 9, 2026
    First seen
    April 15, 2026
    Last seen
    June 12, 2026

    Posting Health

    Days active
    58
    Repost count
    0
    Trust Level
    44%
    Scored at
    June 12, 2026

    Signal breakdown

    freshnesssource trustcontent trustemployer trust
    Kubra
    Kubra
    lever
    Employees
    750
    Founded
    1992
    Domain
    kubra.com
    View company profile
    Newsletter

    Stay ahead of the market

    Get the latest job openings, salary trends, and hiring insights delivered to your inbox every week.

    A
    B
    C
    D
    Join 12,000+ marketers

    No spam. Unsubscribe at any time.

    KubraQuality Assurance EngineerCAD 95000–115000