Sezzle
Sezzle3mo ago
$4,600 – $9,500/yr

Senior Mobile Engineer (LATAM)

Latin AmericaRemotesenior
EngineeringOtherMobile DevelopmentQA & TestingMobile DeveloperMobile Qa Engineer
5 views0 saves0 applied

Quick Summary

Overview

The salary range for this role is $4,600 - $9,500 per month (Gross in USD) About Sezzle: With a mission to financially empower the next generation, Sezzle is revolutionizing the shopping experience beyond payments, blending cutting-edge tech with seamless, interest-free installment plans…

Key Responsibilities

Help own and build out new features within our cross-platform TypeScript React Native app, and Golang backend APIs. Manage our releases, using tools like cohorting, feature flags, and app-store infrastructure to ensure a safe rollout to our millions…

Requirements Summary

You have relentlessly high standards - many people may think your standards are unreasonably high. You are continually raising the bar and driving those around you to deliver great results.

Technical Tools
anthropicawselasticsearchgojavajavascriptkubernetesmysqlpostgresqlpythonreactswifttypescriptci-cdfintechmicroservices

With a mission to financially empower the next generation, Sezzle is revolutionizing the shopping experience beyond payments, blending cutting-edge tech with seamless, interest-free installment plans that make shopping smarter and more accessible. We’re not just transforming payments; we’re redefining how people discover, interact with, and purchase the things they love while driving real impact on merchant sales through increased conversions and higher order values. As we continue to shape the future of fintech and retail, we’re building an innovative, dynamic team passionate about creating more than just a transaction but a truly unique shopping journey. If you’re excited about pushing boundaries in tech and delivering a game-changing experience for consumers and merchants alike, come join us at Sezzle and help create the future of shopping!

About the Role

~1 min read

We are seeking a talented and motivated Senior Mobile Engineer who is best in class with a high IQ plus a high EQ. This role presents an exciting opportunity to thrive in a dynamic, fast-paced environment within a rapidly growing team, with abundant prospects for career advancement.

What We Offer

~1 min read

The compensation range for the role is as follows:

4,600 - 9,500 USD Monthly

We believe transparency is important at Sezzle. Regularly providing feedback while setting expectations is part of our culture starting with the interview process. Advancement through each step is not guaranteed.

  • Application submitted (you are here)
  • Wonderlic test (30-40 min)
  • Coding assessment (~1.5 hours)
  • Interview with recruiters (30 min)
  • Interview with engineers (1 hour)
  • Interview with engineering leadership (30-45 min)
  • Offer!

Responsibilities

~1 min read
  • Help own and build out new features within our cross-platform TypeScript React Native app, and Golang backend APIs.
  • Manage our releases, using tools like cohorting, feature flags, and app-store infrastructure to ensure a safe rollout to our millions of active users.
  • Maintain a strong working relationship with product, design, and the business to ensure stakeholder needs are being evaluated and met.
  • Work with the team to continuously build clean, scalable, robust, and testable code.
  • Develop a deep working knowledge of your application, data domain, and KPIs.
  • 6+ years experience solving technical problems as part of a team.
  • Experience developing and delivering a mobile application to Apple and Google’s mobile app stores.
  • Experience with Swift.
  • Strong familiarity with modern Frontend Development, Javascript or Typescript, and building applications with React Native, or similar cross-platform framework.
  • Understanding of relational databases like MySQL.
  • Bachelor's degree in computer science
  • Demonstrated experience working with Claude or equivalent large language model tools is required; candidates must be comfortable leveraging AI to enhance productivity, research, and communication.

Nice to Have

~1 min read
  • Knowledgeable in writing automated tests for applications (unit, integration, end-to-end), and implementing them in a CI environment.
  • Ability to solve problems with backend-focused languages like Go, Python, Java or similar.
  • Familiarity with typical microservice architecture composed of HTTP APIs.
  • Experience working with native code on iOS, Android.
  • You have relentlessly high standards - many people may think your standards are unreasonably high. You are continually raising the bar and driving those around you to deliver great results. You make sure that defects do not get sent down the line and that problems are fixed so they stay fixed.
  • You’re not bound by convention - your success—and much of the fun—lies in developing new ways to do things
  • You need action - speed matters in business. Many decisions and actions are reversible and do not need extensive study. We value calculated risk-taking.
  • You earn trust - you listen attentively, speak candidly, and treat others respectfully.
  • You have backbone; disagree, then commit - you can respectfully challenge decisions when you disagree, even when doing so is uncomfortable or exhausting. You have conviction and are tenacious. You do not compromise for the sake of social cohesion. Once a decision is determined, you commit wholly.
  • Languages: Golang, Typescript, Python
  • Frontend: Typescript - React and React Native
  • Backend: Golang
  • Database: MySQL, Postgres, Elasticsearch
  • DevOps & Cloud: AWS, Kubernetes
  • Version Control: Git
  • CI/CD: Gitlab
  • Testing: Developer-driven, focus on automated unit, integration, and end-to-end tests
  • Sezzle is focused on using open source, and we build what we can before buying!

At Sezzle, we are more than just brilliant engineers, passionate data enthusiasts, out-of-the-box thinkers, and determined innovators; we are skilled musicians, yogis, cyclists, chefs, golfers, dog-lovers, and rock-climbers. We believe in surrounding ourselves with not only the best and the brightest individuals, but those that are unique and purpose-driven in all that they do. Our culture is not defined by a certain set of perks designed to give the illusion of the traditional startup culture, but rather, it is the visible example living in every employee that we hire. 

#Li-remote #Full-time

Location & Eligibility

Where is the job
LATAM
Remote within a specific region
Who can apply
LATAM
Listed under
LATAM

Listing Details

Posted
March 18, 2026
First seen
March 26, 2026
Last seen
June 27, 2026

Posting Health

Days active
93
Repost count
0
Trust Level
49%
Scored at
June 27, 2026

Signal breakdown

freshnesssource trustcontent trustemployer trust
Sezzle
Sezzle
greenhouse
Employees
350
Founded
2016
View company profile
Newsletter

Stay ahead of the market

Get the latest job openings, salary trends, and hiring insights delivered to your inbox every week.

A
B
C
D
Join 12,000+ marketers

No spam. Unsubscribe at any time.

SezzleSenior Mobile Engineer (LATAM)$5k–$10k