Smartsheet
Smartsheet~1mo ago

Sr. Software Engineer (Hybrid in Bangalore)

OtherSoftware EngineerSoftware Engineering
5 views0 saves0 applied

Quick Summary

Overview

For over 20 years, Smartsheet has helped people and teams achieve–well, anything. From seamless work management to smart, scalable solutions, we’ve always worked with flow. We’re building tools that empower teams to automate the manual, uncover insights, and scale smarter.

Technical Tools
gojavajavascriptkafkamysqlsqlagileci-cddistributed-systemssystem-design

For over 20 years, Smartsheet has helped people and teams achieve–well, anything. From seamless work management to smart, scalable solutions, we’ve always worked with flow. We’re building tools that empower teams to automate the manual, uncover insights, and scale smarter. But more than that, we’re creating space– space to think big, take action, and unlock the kind of work that truly matters. Because when challenge meets purpose, and passion turns into progress, that’s magic at work, and it’s what we show up for everyday.

Our India Global Capability Center isn't just supporting global operations—we’re leading global innovation. After scaling rapidly into a best-in-class hub, we deliver the product innovation and enterprise capabilities that accelerate our global growth, profitability, and scale. As we expand Smartsheet India, we’re searching for Senior Software Engineers who crave variety and ownership. Whether your expertise is in front-end, back-end, test automation, ops, or infrastructure, you’ll have the opportunity to work across multiple teams and disciplines, building a versatile skillset while solving the complex challenges of a global platform. 

  • Work on all areas of the software from front end, back end, cloud infrastructure and test automation
  • Drive high standards within the team for all internal services and open source tooling/libraries we maintain
  • Deploy service and infrastructure changes frequently in a lean agile environment using full CI/CD
  • Contribute in all aspects of product development: idea generation, customer engagement, planning, design, prototyping, execution, shipping, and operational excellence
  • Collaborate with a team of passionate, engaged engineers, and with cross-functional teams that include product managers, UX designers, UX researchers, and more
  • Actively mentor more junior engineers, showing how to balance customer delivery while holding high coding, service, and cloud infrastructure standards
  • Apply different approaches to problem solving and help validate your ideas and those of your teammates
  • Strategically apply and champion AI tools within your team's domain to improve project execution, system design, quality, and debugging, leading adoption of AI best practices and driving measurable productivity gains
  • Help define success for yourself, your team, and the features you help to conceive, build, and ship
  • Perform other duties as assigned
  • 7+ years of experience in Backend / Fullstack development
  • Proficient with at least one of the following: Golang, Java, Node.js
  • Familiar with algorithms, data structures, and coding best practices
  • Curious, and always want to get to the bottom of why things work the way they do
  • A supportive leader. You want to help people get unstuck, and can easily recognise that teams are more effective when colleagues look for opportunities to help one another.
  • A great communicator. You can break a concept down based on your audience, whether they’re technical or non-technical - and your medium, whether it’s verbal, in prose, or in code
  • A builder who takes pride in your craft and works toward quality
  • An empathic individual who can help translate customer feedback and needs into features that solve problems
  • Someone who views bugs, mistakes, and compiler errors as opportunities to learn
  • Legally eligible to work in India on an ongoing basis
  • Fluency in English is required
  • Experience with distributed systems at scale
  • Understands event-driven architecture’s principles, advantages and limitations, and can apply it appropriately
  • Hands-on experience with Kinesis, Kafka, or similar
  • Experience with Go or other C-like languages such as Java
  • Experience with improving large-scale event processing systems is desirable
  • Experience with database log streams e.g. MS-SQL Transaction Logs, MySQL Bin Logs is desirable
  • Experience with stream processing frameworks such as Flink, Spark, or other is desirable
  • Squad lead or team lead experience is desirable

 

At Smartsheet, your ideas are heard, your potential is supported, and your contributions have real impact. You’ll have the freedom to explore, push boundaries, and grow beyond your role. We welcome diverse perspectives and nontraditional paths—because we know that impact comes from individuals who care deeply and challenge thoughtfully. When you’re doing work that stretches you, excites you, and connects you to something bigger, that’s magic at work. Let’s build what’s next, together.

Smartsheet is an Equal Opportunity (EEO) employer committed to fostering an inclusive environment with the best employees. It is our policy to provide equal employment opportunities to all qualified applicants in accordance with applicable laws in the US, UK, Australia, Germany, Costa Rica, Japan, Bulgaria, and India. All qualified applicants will receive consideration without regard to race, color, religion, sex, sexual orientation, gender identity, national origin, age, protected veteran or disabled status, or genetic information. 

If there are preparations we can make to help ensure you have a comfortable and positive interview experience, please let us know.

 

#LI-Remote

Location & Eligibility

Where is the job
Bangalore, India
On-site at the office
Who can apply
IN
Listed under
India

Listing Details

First seen
March 25, 2026
Last seen
May 12, 2026

Posting Health

Days active
47
Repost count
0
Trust Level
31%
Scored at
May 12, 2026

Signal breakdown

freshnesssource trustcontent trustemployer trust
Smartsheet
Smartsheet
greenhouse

The foundation for managing projects, programs, and processes that scale.

Employees
3k+
Founded
2005
View company profile
Newsletter

Stay ahead of the market

Get the latest job openings, salary trends, and hiring insights delivered to your inbox every week.

A
B
C
D
Join 12,000+ marketers

No spam. Unsubscribe at any time.

Smartsheet Sr. Software Engineer (Hybrid in Bangalore)