~4mo ago

Senior Full-Stack Software Engineer (Tokyo Onsite Only)

JapanJapan·Minato Citysenior
OtherFull Stack Software Engineer
1 views0 saves0 applied

Quick Summary

Overview

Visual Alpha Senior Full-Stack Software Developer Role (Tokyo Onsite) Join Visual Alpha to use the latest technologies to disrupt the investment management industry!

Technical Tools
awscirclecicppgraphqllaravelphppythonreactrustsqlagileb2bdata-analysisetlfintechrest-apissystem-design

Visual Alpha Senior Full-Stack Software Developer Role (Tokyo Onsite)

Join Visual Alpha to use the latest technologies to disrupt the investment management industry!

 

Visual Alpha is a B2B fintech startup based in central Tokyo that provides an innovative AI powered data analytics service to financial institutions, including institutional investors, financial data publishers and accounting firms. We develop our full stack web applications using the latest AI and Cloud technologies. We are currently hiring for a senior software engineer role to design and implement features on our core software service. 

 

- Fast growing exciting tech startup
- No Japanese language is required (English must be fluent!) 
- Relocate to Tokyo (Onsite only)
- Hybrid in-office/remote working style

Opportunity

  • Work for a fast growing B2B fintech startup to innovate investment management

  • Join a diverse international team of data science and investment experts

  • Become one of the earliest members of a promising startup

Role

  • Independently develop fund performance calculation systems for institutional asset managers. 

  • Create and maintain complex business logic modules and data models.

  • Design scalable framework for onboarding new types of client mandates, securities, funds, and trade instructions. 

  • Work with the support team closely to onboard client mandates and support client daily operations.

  • Create unit tests and integration tests to ensure quality.

  • Potentially manage a small team (2~3 people) including interns.

  • Typical time allocation: design 20%, implementation 80%. 

Required Skills

  • A love of learning and proven experience in becoming a domain expert; in our case, you will become an expert in investment data analysis and investment reporting visualization

  • Very strong problem solving skills that can handle complex issues independently.

  • Pragmatic experience with Agile development methodologies (Scrum, eXtreme Programming, etc) and iterative process improvements

  • Self-motivated, client-oriented thinking, ability to learn new technologies quickly

  • Strong design, presentation, and collaboration skills; must be a strong team player

  • Good knowledge of NodeJS or desire to learn coupled with strong experience in one of C++, Python, PHP, or Rust

  • Native (or very fluent) in English

Desired Skills

  • Knowledge of investment management (significant advantage)

  • Strong at mathematical calculation programming (significant advantage)

  • Strong background in merging datasets from various offline and online sources (ex: ETL systems, data lakes, etc)

  • Experience implementing various design patterns

  • Familiarity with xUnit design concepts and patterns

  • Experience creating web-services and/or AI models

Technologies

NodeJS, React, PHP (Laravel), Python, SQL, GraphQL, Restful API, AWS, CircleCI, Git, xUnit


A Day in the Life 

Generally you’ll be working in “sprints”: Everyone on the dev team delivers features to our client in a 1~2 weeks sprint. We encourage developers to deliver features to our clients independently by implementing a well designed full stack solution reviewed by the team.


So your day might break down like this:


Morning: Come in around 9am, check messages, emails, arrange short, medium and long-term to-do lists. Note that under the current covid situation, we only come to the office once or twice a week. Carry out coding, problem-solving and development. At various points you will ask for advice (or give advice). After you find a solution, you’d usually create a “change request” or “pull request” summarizing changes proposed. This would probably bring you to lunch. 


Afternoon: The afternoon is often when meetings are held and longer-term projects are discussed. After design discussions, you’re given a list of requirements, and then you would have to document the system design and get it reviewed. 


End of Day: Wrap up work and get critical questions clarified before the end of day. Most people will leave around 5:30pm, and sometimes we have a bit after work drinks toward the weekend. We are flexible with working hours, but rather emphasizing on efficiency and quality. 




Location & Eligibility

Where is the job
Minato City, Japan
On-site at the office
Who can apply
JP

Listing Details

First seen
May 6, 2026
Last seen
October 1, 2026

Posting Health

Days active
147
Repost count
0
Trust Level
19%
Scored at
October 1, 2026

Signal breakdown

freshnesssource trustcontent trustemployer trust
Newsletter

Stay ahead of the market

Get the latest job openings, salary trends, and hiring insights delivered to your inbox every week.

A
B
C
D
Join 12,000+ marketers

No spam. Unsubscribe at any time.

Senior Full-Stack Software Engineer (Tokyo Onsite Only)