Cyara
Cyara3mo ago
↻ Repost

Sr. Software Engineer

HyderabadHybridsenior
Software EngineerSoftware Engineering
3 views0 saves0 applied

Quick Summary

Overview

Cyara is the global leader in AI-powered customer experience assurance, committed to eradicating bad CX. As the only unified platform for continuous testing and monitoring across voice, digital, messaging, and conversational AI channels, Cyara empowers hundreds of the world’s leading brands to…

Technical Tools
awsdockerflaskgrafanamysqlpytestpythonredissqlagiledeep-learninglinuxmachine-learningperformance-optimizationrest-apisstreaming-data
Cyara is the global leader in AI-powered customer experience assurance, committed to eradicating bad CX. As the only unified platform for continuous testing and monitoring across voice, digital, messaging, and conversational AI channels, Cyara empowers hundreds of the world’s leading brands to optimize more than 350 million customer journeys every year. With enterprises rapidly deploying agentic AI systems that adapt, learn, and make autonomous decisions in real time, Cyara provides the assurance layer that turns pilots into production-ready deployments—testing AI agents with AI agents to catch what scripts can’t. From full journey visibility to AI governance, trust validation, and compliance, Cyara ensures every touchpoint works flawlessly and every AI interaction solves customer problems while delighting them in the process. Cyara helps businesses deliver secure, friction-free, and high-quality CX at scale. Interested to find out more about us?  Check out:  www.cyara.com

Cyara’s Values: 
At Cyara, our values shape everything we do. We're passionate about Delivering Excellence by putting the customer first, collaborating globally, and always striving to improve. We take smart risks and Innovate Boldly, setting new standards and learning from every experience. Integrity First is our cornerstone—we value humility, authenticity, and respect for diversity, building trust in all we do. We Embrace Curiosity by empowering you to experiment, learn, and grow in a dynamic environment. At Cyara, our values drive us forward, shaping a culture where innovation and excellence thrive. 

Cyara’s Diversity, Equity, Inclusive and Belonging: 
At Cyara, we are dedicated to fostering a workplace that embodies equal opportunity and champions diversity, equity, inclusion, and belonging (DEIB). We strive to cultivate an environment where every individual feels valued, respected, and empowered to bring their whole selves to work, contributing unique perspectives and talents. Our commitment includes continuously evaluating and enhancing our policies, practices, and culture to align with our DEIB principles. We ensure a discrimination-free environment where individuals are evaluated solely on their merits and abilities, regardless of legally protected statuses such as sex, race, color, ethnicity, national origin, age, religion, disability, sexual orientation, gender identity, veteran status, or medical condition. By celebrating our differences and championing inclusivity, we enrich our organization, make more thoughtful decisions, and drive collective success. 
  • We are currently hiring for a Back-End Developer to design, build and maintain a backend API that will that provides various functionality to end-users. The backend is built on Cockroach DB and Python Flask. The successful candidate will be responsible for designing and developing new API endpoints based on the input coming from different teams and projects. In addition, you will also work on integration, maintaining and training AI/ML models focused on audio quality and telephony environment.
  • Strong command of Python (preferably 3.x) with experience in writing clean, modular, and maintainable code.
  • Familiarity with Python libraries commonly used in Flask projects (e.g., requests and other relevant to your stack).
  • Proficiency with SQL Alchemy
  • Experience designing and managing database schemas and relationships (e.g., one-to-many, many-to-many) and performing migrations using Alembic.
  • Strong understanding of relational databases (e.g., MySQL) and ability to write efficient SQL queries.
  • Experience with Redis for caching, session management, or real-time data processing.
  • Experience with machine learning workflows, including model training, evaluation, and deployment.
  • Knowledge of database optimization, indexing, and transaction management.
  • Understanding Flask concepts like routing and request handling.
  • Solid grasp of HTTP protocols, RESTful API development, and web application architecture.
  • Experience with API testing tools (e.g., Postman, curl) and debugging.
  • Familiarity with version control using Git (GitHub).
  • Familiarity with deployment tools and platforms (e.g., Docker, AWS).
  • Knowledge of testing frameworks like pytest and unittest for unit and integration testing.
  •  
  • 5+ years of experience in backend development
  • 3+ years of experience with Python
  • Strong problem-solving skills and the ability to work collaboratively in a team environment
  • Hands-on machine learning experience, with a focus on NLP and deep learning.
  • Ability to work with AI/ML models and run them in a Docker environment.
  • Understanding audio quality parameters and audio measurements techniques.
  • Strong knowledge of databases, including performance tuning and optimization.
  • Proficient with version control systems, particularly Git (GitHub).
  • Solid understanding of docker
  • Experience working in Unix/Linux environments.
  • Excellent communication skills, both written and verbal in English
  • Familiarity with monitoring tools such as Grafana is a plus.
  • Familiarity with Scrum practices
  • Location & Eligibility

    Where is the job
    Hyderabad
    Hybrid — some on-site time required
    Who can apply
    Same as job location
    Listed under
    Worldwide

    Listing Details

    Posted
    February 2, 2026
    First seen
    March 26, 2026
    Last seen
    May 15, 2026

    Posting Health

    Days active
    49
    Repost count
    1
    Trust Level
    32%
    Scored at
    May 15, 2026

    Signal breakdown

    freshnesssource trustcontent trustemployer trust
    Cyara
    Cyara
    lever

    Cyara is an AI-powered CX Transformation Platform provider that helps enterprises deliver flawless customer interactions across various channels through automated testing and monitoring.

    Employees
    350
    Founded
    2006
    Domain
    cyara.com
    View company profile
    Newsletter

    Stay ahead of the market

    Get the latest job openings, salary trends, and hiring insights delivered to your inbox every week.

    A
    B
    C
    D
    Join 12,000+ marketers

    No spam. Unsubscribe at any time.

    CyaraSr. Software Engineer