Emburse13h ago

New

Engineering Manager

United States·DallasFull-Timemid

EngineeringEngineering Manager

0 views0 saves0 applied

Apply Now

Quick Summary

Overview

Who We Are: At Emburse, you’ll not just imagine the future – you’ll build it. As a leader in travel and expense solutions,

Technical Tools

angularexpressjavascriptjenkinsmysqlreactsqltypescriptagileproject-managementtdd

Who We Are:

At Emburse, you’ll not just imagine the future – you’ll build it. As a leader in travel and expense solutions, we are creating a future where technology drives business value and inspires extraordinary results. Our AI-powered platform helps organizations modernize financial operations, increase visibility, and optimize spend across the enterprise.

We are looking for an experienced, detail-oriented, Engineering Manager to join our growing team! In this position, you will play a key role in the overall success of our organization by planning, managing, and monitoring our engineering function and team members. You will be responsible for successful completion of projects by overseeing a robust project management process and delivery timelines to keep projects schedule and within budget. This role has an option to work remotely from anywhere in Eastern or Central regions of the US.

Supervise engineering employees and manage their performance.

Manage the retention of the team, implementing and improving processes related to software delivery into production environments and managing partner/vendor and cross-relationships for software and system integrations.

Agree schedules and scope with stakeholders and ensure engineers deliver (write and deploy) software to the commitments made.

Implement appropriate remediations where schedule or scope agreements cannot be met.

Track metrics about the team's performance and performance against other objectives (e.g. software reliability and bugs).

Bachelor’s degree required, or foreign equivalent, in Computer Science, Data Science, Software Engineering, or related field

Six (6) years of progressively responsible experience in the job offered, or as Software Developer or related position

Full term of experience must include each of the following: JavaScript and TypeScript development;

SQL and SQL database integration;

Working in OS X environments, NoSQL, and GIT;

Working in a scrum environment;

Agile Application Development Lifecycle; Common design patterns;

Working with 3rd party APIs, workflow and integration architectures;

TDD and unit testing; XML, JSON or REST services, and APIs;

Messaging infrastructure; Jenkins; JavaScript and TypeScript development;

HTML and CSS; NPM and Webpack;

React and React- Redux; React Router; and, Complying with PCI DSS requirements.

One year’s experience in each of the following: AngularJS (“Angular 1”); Stylus; Sequelize (v5); MySQL; Node.js; Express; and React & React-Redux migration from AngularJS (“Angular 1”).

Location & Eligibility

Where is the job

Dallas, United States

Hybrid — some on-site time required

Who can apply

Listing Details

Posted: May 11, 2026
First seen: May 11, 2026
Last seen: May 11, 2026

Posting Health

Days active: 0
Repost count: 0
Trust Level: 70%
Scored at: May 11, 2026

Signal breakdown

freshnesssource trustcontent trustemployer trust

Apply for this position

Emburse

lever

Emburse humanizes work by empowering business travelers, finance professionals and CFOs to eliminate manual, time-consuming tasks so they can focus on what matters most.

Employees

750

Founded

2020

Domain

Jobs

External application · ~5 min on Emburse's site

Please let Emburse know you found this job on Jobera.