Swile
Swile3mo ago

Engineering Manager

FranceFrance·MontpellierPermanentmid
EngineeringEngineering Manager
4 views0 saves0 applied

Quick Summary

Overview

At Swile, we believe that good products can help reduce friction in daily professional life and boost employee satisfaction. Today, we provide innovative solutions in various areas such as Fintech, Travel, HR, and Employee Benefits to more than 5.5 million users in 85,000 companies in France and…

Technical Tools
awsjavascriptkafkakotlinkubernetespostgresqlrailsreactrubysnowflakeswifttypescriptfintechpeople-managementperformance-management

At Swile, we believe that good products can help reduce friction in daily professional life and boost employee satisfaction. Today, we provide innovative solutions in various areas such as Fintech, Travel, HR, and Employee Benefits to more than 5.5 million users in 85,000 companies in France and Brazil.

As an Engineering Manager, your primary role is to lead a team of software engineers in creating impactful software products. This involves guiding the team's technical direction, helping them do better, and making sure they meet their goals and roadmaps. Additionally, you'll help build a sustainable engineering environment that supports long-term growth and innovation.

 

 

  • Balance strong technical skills with effective people management abilities.

  • Drive the creation and execution of roadmaps.

  • Lead teams in delivering multiple projects in various areas.

  • Engage in technical discussions, contribute to software architecture, and facilitate problem-solving.

  • Measure team impact, establish clear expectations and goals.

  • Oversee the software development lifecycle, implementing best-in-class engineering practices.

  • Collaborate effectively with cross-functional partners and stakeholders to achieve optimal outcomes.

  • Mentor and support the professional development of team members, fostering a culture of excellence and continuous improvement.

  • Encourage innovation and innovative thinking among team members.

  • Communicate effectively with team members, peers, and stakeholders, translating complex technical concepts into clear terms as necessary.

  • Lead by example, establishing a positive work environment and promoting team cohesion

We welcome individuals with entrepreneurial backgrounds as well as those from established organizations. At Swile, we believe that delivering impactful products requires engineers to understand the needs of users and clients as well as the code itself.

  • Solid background in software engineering, and proven experience in team management.

  • Leadership skills with the ability to motivate and guide a team.

  • Demonstrated ability to manage complex projects and cross-functional teams.

  • Demonstrated experience recruiting and managing technical teams, including performance management

  • You do not need to be familiar with our technical stack or any specific functional area, but we have a strong willingness to learn and adapt quickly.

  • You are a future responsible swiler: you share our commitment to the environment, diversity, fairness and inclusion and are prepared to work every day to improve individual and collective performance.
Ruby/Rails, Typescript/React/Node.js, Android(Kotlin), iOS(Swift), AWS/Kubernetes, PostgreSQL, Kafka, Snowflake
  • An opportunity to lead a dynamic team of talented engineers.

  • A collaborative work environment that values innovation and creativity.

  • Competitive salary and benefits package.

  • Professional development and career growth opportunities.

Location & Eligibility

Where is the job
Montpellier, France
Hybrid — some on-site time required
Who can apply
FR

Listing Details

Posted
May 7, 2026
First seen
May 7, 2026
Last seen
August 24, 2026

Posting Health

Days active
100
Repost count
0
Trust Level
33%
Scored at
August 16, 2026

Signal breakdown

freshnesssource trustcontent trustemployer trust
Swile
Swile
lever

Swile is a pioneering company in employee benefits, offering a smartcard and app that integrates meal, gift, and mobility vouchers to enhance employee engagement.

Employees
350
Founded
2018
Domain
swile.co
View company profile
Newsletter

Stay ahead of the market

Get the latest job openings, salary trends, and hiring insights delivered to your inbox every week.

A
B
C
D
Join 12,000+ marketers

No spam. Unsubscribe at any time.

SwileEngineering Manager