Entefy83mo ago

Senior Full Stack Engineer (Remote Position)

RemoteFull Timesenior

EngineeringOtherFullstack Developer

3 views0 saves0 applied

Apply Now

Quick Summary

Overview

Requirements Summary

It takes something special to join the Entefy mission. Specifically, it takes creativity, curiosity, and collaboration. The ideal candidate for this role possesses: 6+ years of relevant backend and web experience Strong working knowledge of…

Technical Tools

javascriptkafkareactsqlci-cdtdd

We are looking for an exceptional, broadly experienced software engineer to join the Entefy team, building a full stack application from frontend to backend services with multiple databases to make things interesting. Can you wear many hats? If so, at Entefy, you can help build the next-generation platform to transform digital interaction for people and thinking machines. You will not only be a coder, but rather a key contributor in building highly impactful technology used by some of the largest companies in the world.

Skills and Experience:

It takes something special to join the Entefy mission. Specifically, it takes creativity, curiosity, and collaboration. The ideal candidate for this role possesses:

6+ years of relevant backend and web experience

Strong working knowledge of front-end JavaScript and modern libraries including React.js

Deep knowledge of Node.js and SQL

Proven track record in architecting and building scalable systems

ETP (Exceptional Technical Prowess)

Courage to innovate and fail

Strong collaboration and communication skills

Experience with large distributed data systems

Ability to build highly performant APIs to power data visualizations

Experience dealing with scalability requirements and performance improvements

Know-how dealing with building and maintaining complex event-driven systems is a plus (i.e. Kafka)

Prior experience with Continuous Integration and test-driven development is a plus

Startup experience is a plus

Location & Eligibility

Where is the job

Worldwide

Fully remote, anywhere in the world

Who can apply

Same as job location

Listed under

Worldwide

Listing Details

Posted: July 9, 2019
First seen: March 26, 2026
Last seen: May 13, 2026

Posting Health

Days active: 47
Repost count: 0
Trust Level: 30%
Scored at: May 13, 2026

Signal breakdown

freshnesssource trustcontent trustemployer trust

Apply for this position

Entefy

lever

Entefy is an AI software and automation company that provides a unified intelligence platform to help enterprises accelerate digital transformation and improve existing systems. Their multisensory AI technology is designed to enhance knowledge management, process automation, cybersecurity, data privacy, and customer analytics.

Employees

Founded

2012

Domain

Jobs

External application · ~5 min on Entefy's site

Please let Entefy know you found this job on Jobera.